ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.38 ()

regulator of chromosome condensation, putative, a gene from Plasmodium falciparum

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12743

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL7P1.38 regulator of chromosome condensation, putative
  • PBANKA_122210 regulator of chromosome condensation protein, putative
  • PY01893 Regulator of chromosome condensation, putative
  • PVX_088110 hypothetical protein, conserved
  • PCHAS_122280 regulator of chromosome condensation protein, putative
  • PKH_010970 regulator of chromosome condensation, putative
  • NCLIV_013660 regulator of chromosome condensation, putative
  • cgd4_1350 regulator of chromosome condensation
  • Chro.40154 regulator of chromosome condensation
  • CMU_028450 regulator of chromosome condensation family protein
  • TA17690 regulator of chromosome condensation protein, putative
  • BBOV_III001630 regulator of chromosome condensation (RCC1) domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL7P1.38 regulator of chromosome condensation, putative
MYKTYVYNLKDKRECGQLPPEYCTDYVQVNPTAIPNLPNDIDEVICGSMHTIIKTTDDKLYSFGCNDMGVLGRKTYSSGI
KDLEHSPTLINFTFPSKIKKITCGDNHTAILLENGKVYITGGFRDYCGVLGLPSFGEKNELLTKSFEFIEIQFSYNNNNN
NNNSNNNNGGILKSQDSYENHTYDKSNNSIDLKDEDIKIINIISGEDHLICLDESHEYIFTMGNSDSCQVCNNFYEQEDS
EEQRIKYVYPNCYHYTYFGFENKFENIYCGGNNTYVQLENSLDVYGIGRNAYGSCGVSSKDNIIKKFEKIQELSQKKINQ
LCGGQSFTVCLLNNNDLYIWGNREILGMEYDDDAYSPLELDFFKKNNYTVKNITCGTDHCLVLTDNGKLFGWGTGGNEFD
ENTSLAVIEKNEPSEIDFFKFVKKMILKCNKNDSELLHQNLIQIVSFAGGSSHCAFISSHIDTDRVSVKRGYDEIYDEDM
LSKKHKRDNNNNYNDIQNENRDLEQIDAHDEIVKKYLEEKKNQIQNEDDKMDKTYKVNKNKGKDHTYIKDTYYDKSTNKY
STKDMSQPLDKINEQSEGSNLPSEQNKRRRSVKTKSYLSNESPTRKQPRRSCKEHTSLNENANKKFYQIIDKPIIKKKRK
TTTSMKNKNTNLKEAQSPSGKRKVKSVGSRRESLSAPISKKDNLKRE

Gene-Specific Links for MAL7P1.38

General Sub-Cellular Localisation Links