ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.27 (CRT)

chloroquine resistance transporter, a gene from Plasmodium falciparum

Compiled localisation
food vacuole during early trophozoite and schizont and trophozoite
not food vacuole lumen during trophozoite
residual body membrane during after rupture
food vacuole membrane during early schizont
endoplasmic reticulum during early trophozoite

Who localised this protein by microscopy?

Kuhn, Y., Sanchez, C. P., Ayoub, D., Saridaki, T., van Dorsselaer, A., Lanzer, M.
Trafficking of the phosphoprotein PfCRT to the digestive vacuolar membrane in Plasmodium falciparum. (2010 Feb, Traffic) PubMed / full text
   more detail about this publication

endoplasmic reticulum and food vacuole during early trophozoite
  • "A strong perinuclear fluorescence indicative of a localization at the ER was observed in the brefeldin A treated parasites, which was absent in the untreated controls (Figure 8)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: food vacuole and ER during young trophozoite
  • Other genes localised in this publication: -

Raj, D. K., Mu, J., Jiang, H., Kabat, J., Singh, S., Sullivan, M., Fay, M. P., McCutchan, T. F., Su, X. Z.
Disruption of a Plasmodium falciparum multidrug resistance-associated protein (PfMRP) alters its fitness and transport of antimalarial drugs and glutathione. (2009 Mar 20, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole membrane
  • "To further characterize the protein expression patterns and localization of PfMRP in different developmental stages, we performed immunofluorescent assay using antibodies against PfMRP, PfMSP-1 (a protein on merozoite plasma membrane), PfCRT (on food vacuole membrane), and PfMDV-1 (gametocyte-specific)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: food vacuole membrane
  • Other genes localised in this publication: ABC transporter, (CT family), putative, merozoite surface protein 1, male development gene 1

Green, J. L., Rees-Channer, R. R., Howell, S. A., Martin, S. R., Knuepfer, E., Taylor, H. M., Grainger, M., Holder, A. A.
The motor complex of Plasmodium falciparum: phosphorylation by a calcium-dependent protein kinase. (2008 Nov 7, J Biol Chem) PubMed / full text
   more detail about this publication

residual body membrane during after rupture, food vacuole membrane during early schizont
  • "To exclude the possibility that CDPK1 is present within the food vacuole membrane, we stained parasites with antibodies against PfCRT, a known marker of the food vacuole membrane. There was no coincidence of staining in early schizonts and a small amount of colocalization in segmented schizonts (Fig. 2B, panel iv and v). "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: residual body membrane during following schizont rupture, FVM during early schizont
  • Other genes localised in this publication: calcium dependent protein kinase 1, myosin A tail domain interacting protein, merozoite surface protein 1

Subramanian, S., Sijwali, P. S., Rosenthal, P. J.
Falcipain cysteine proteases require bipartite motifs for trafficking to the Plasmodium falciparum food vacuole. (2007 Aug 24, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole during trophozoite
  • "Co-localization of proFP2-GFP and proFP3-GFP was also observed with antibodies directed against the endogenous food vacuolar proteins falcipain-2, falcipain-3 (12), and the P. falciparum Chloroquine Resistance Transporter (PfCRT) (26) (Fig. 2)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: FV during troph
  • Other genes localised in this publication: cysteine proteinase falcipain 2a, cysteine proteinase falcipain 3

Cooper, R. A., Ferdig, M. T., Su, X. Z., Ursos, L. M., Mu, J., Nomura, T., Fujioka, H., Fidock, D. A., Roepe, P. D., Wellems, T. E.
Alternative mutations at position 76 of the vacuolar transmembrane protein PfCRT are associated with chloroquine resistance and unique stereospecific quinine and quinidine responses in Plasmodium falciparum. (2002 Jan, Mol Pharmacol) PubMed / full text
   more detail about this publication

food vacuole and not food vacuole lumen during trophozoite
  • "Using immunoelectron microscopy and gold-conjugated anti-PfCRT-K IgG antibody, we have now definitively localized PfCRT to the membrane of the DV in trophozoite-stage par- asites (Fig. 6). "
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Dd2
  • Gene model mapping comments: inferred from another publication
  • Localisation record: fv and not fv lumen during trophozoite
  • Other genes localised in this publication: -

Fidock, D. A., Nomura, T., Talley, A. K., Cooper, R. A., Dzekunov, S. M., Ferdig, M. T., Ursos, L. M., Sidhu, A. B., Naude, B., Deitsch, K. W., Su, X. Z., Wootton, J. C., Roepe, P. D., Wellems, T. E.
Mutations in the P. falciparum digestive vacuole transmembrane protein PfCRT and evidence for their role in chloroquine resistance. (2000 Oct, Mol Cell) PubMed / full text
   more detail about this publication

food vacuole during schizont and trophozoite
  • "Green fluorescence localizes PfCRT to the DV around the hemozoin pigment."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, FLAG tag
  • Strain: 34-1/Erm
  • Gene model mapping comments: Blast from AF233068, inconsistent 5' UTR
  • Localisation record: Food Vacuole during trophozoite and schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_16344

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL7P1.27 chloroquine resistance transporter
MKFASKKNNQKNSSKNDERYRELDNLVQEGNGSRLGGGSCLGKCAHVFKLIFKEIKDNIFIYILSIIYLSVCVMNKIFAK
RTLNKIGNYSFVTSETHNFICMIMFFIVYSLFGNKKGNSKERHRSFNLQFFAISMLDACSVILAFIGLTRTTGNIQSFVL
QLSIPINMFFCFLILRYRYHLYNYLGAVIIVVTIALVEMKLSFETQEENSIIFNLVLISALIPVCFSNMTREIVFKKYKI
DILRLNAMVSFFQLFTSCLILPVYTLPFLKQLHLPYNEIWTNIKNGFACLFLGRNTVVENCGLGMAKLCDDCDGAWKTFA
LFSFFNICDNLITSYIIDKFSTMTYTIVSCIQGPAIAIAYYFKFLAGDVVREPRLLDFVTLFGYLFGSIIYRVGNIILER
KKMRNEENEDSEGELTNVDSIITQ

Gene-Specific Links for MAL7P1.27

General Sub-Cellular Localisation Links