ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.231 (HRPII, hrp2, pfhrp2, hrpII)

histidine-rich protein II, a gene from Plasmodium falciparum

Compiled localisation
erythrocyte cytoplasm during ring
erythrocyte periphery and not food vacuole during ring and trophozoite
erythrocyte cytoplasmic structure during intraerythrocytic and several hours post invasion

Who localised this protein by microscopy?

McIntosh, M. T., Vaid, A., Hosgood, H. D., Vijay, J., Bhattacharya, A., Sahani, M. H., Baevova, P., Joiner, K. A., Sharma, P.
Traffic to the malaria parasite food vacuole: a novel pathway involving a phosphatidylinositol 3-phosphate-binding protein. (2007 Apr 13, J Biol Chem) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm during ring
  • "HRPII was localized predominantly to the cytoplasm of the host infected erythrocyte (anti-HRPII)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: predominantly cytoplasm of host infected erythrocyte during ring
  • Other genes localised in this publication: conserved Plasmodium protein, unknown function

Lopez-Estrano, C., Bhattacharjee, S., Harrison, T., Haldar, K.
Cooperative domains define a unique host cell-targeting signal in Plasmodium falciparum-infected erythrocytes. (2003 Oct 14, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

erythrocyte cytoplasm
  • "As shown in Fig. 2Ai, green fluorescence caused by PfHRPIIGFP (which represents 90% of the GFP signal) is detected over the parasite (p), tubovesicular membranes extending from the parasite (arrow), and erythrocyte (e) in live cells."
  • Microscopy type: Light
  • Microscopy method: GFP
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Erythrocyte Cytoplasm
  • Other genes localised in this publication: skeleton-binding protein 1

Akompong, T., Kadekoppala, M., Harrison, T., Oksman, A., Goldberg, D. E., Fujioka, H., Samuel, B. U., Sullivan, D., Haldar, K.
Trans expression of a Plasmodium falciparum histidine-rich protein II (HRPII) reveals sorting of soluble proteins in the periphery of the host erythrocyte and disrupts transport to the malarial food vacuole. (2002 Aug 9, J Biol Chem) PubMed / full text
   more detail about this publication

erythrocyte periphery and not food vacuole during ring and trophozoite
  • "Here we show that 97% of endogenous Plasmodium falciparum (Pf) HRPII (PfHRPII) is secreted as soluble protein in the periphery of the red cell and avoids endocytosis by the parasite, and 3% remains membrane-bound within the parasite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein, myc tag
  • Strain: 3D7, E8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: RBC periphery and not FV during ring and troph
  • Other genes localised in this publication: plasmepsin I, heat shock protein 70, ER lumen protein retaining receptor

Bozdech, Z., VanWye, J., Haldar, K., Schurr, E.
The human malaria parasite Plasmodium falciparum exports the ATP-binding cassette protein PFGCN20 to membrane structures in the host red blood cell. (1998 Nov 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

erythrocyte cytoplasmic structure during intraerythrocytic and several hours post invasion
  • "In agreement with previous findings, the PFHRP2 specific monoclonal antibody 1D6 detected a diffuse spotted immunofluorescence pattern in the EC that starts at several hours post invasion and persists throughout the cycle."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: FAC8
  • Gene model mapping comments: inferred from another publication
  • Localisation record: diffuse spotted in the erythrocyte cytoplasm during several hours post invasion and asexual
  • Comment: not colocalised with GCN20
  • Other genes localised in this publication: ABC transporter GCN20

Orthology

OrthoMCL

Part of OrthoMCL group OG4_89489

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.231 histidine-rich protein II
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHAHHVADAHHAHHVADAHHAHH
VADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAH
HAHHASDAHHAHHAAYAHHAHHASDAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAADAHHAADAHHAADAHHA
TDAHHAHHAADAHHATDAHHAHHAADAHHAAAHHATDAHHAAAHHATDAHHAAAHHEAATHCLRH

Gene-Specific Links for MAL7P1.231

General Sub-Cellular Localisation Links