ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.176 (EBA-175, EBA175)

erythrocyte binding antigen-175, a gene from Plasmodium falciparum

Compiled localisation
apical end of surface and not parasite plasma membrane during merozoite
microneme during extracellular merozoite and late schizont and merozoite and schizont
not rhoptry during extracellular merozoite and late schizont and schizont
apical and parasite plasma membrane during extracellular merozoite
not microneme and rhoptry neck during schizont

Who localised this protein by microscopy?

Srivastava, A., Singh, S., Dhawan, S., Mahmood Alam, M., Mohmmed, A., Chitnis, C. E.
Localization of apical sushi protein in Plasmodium falciparum merozoites. (2010 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry neck and not microneme during schizont
  • "Fig. 2. Co-localization of PfASP in late stage P. falciparum schizonts with microneme protein, EBA-175 (A); rhoptry bulb protein, Clag3.1 (B); and rhoptry neck protein, PfAARP (C)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry neck and not microneme during schizont
  • Other genes localised in this publication: apical sushi protein, asparagine-rich protein, cytoadherence linked asexual protein 3.2

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

microneme

Wickramarachchi, T., Cabrera, A. L., Sinha, D., Dhawan, S., Chandran, T., Devi, Y. S., Kono, M., Spielmann, T., Gilberger, T. W., Chauhan, V. S., Mohmmed, A.
A novel Plasmodium falciparum erythrocyte binding protein associated with the merozoite surface, PfDBLMSP. (2009 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme and not parasite plasma membrane during merozoite
  • "(H) Co-localization studies of GFP-PfDBLMSP fusion protein with the microneme marker EBA-175 by immunofluorescence. The GFP fusion protein was present over the merozoite surface (green) whereas the microneme marker showed punctate staining (red)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not surface during merozoite
  • Comment: PMID is also 19640465
  • Other genes localised in this publication: duffy binding-like merozoite surface protein, merozoite surface protein 1

Mphande, F. A., Ribacke, U., Kaneko, O., Kironde, F., Winter, G., Wahlgren, M.
SURFIN4.1, a schizont-merozoite associated protein in the SURFIN family of Plasmodium falciparum. (2008, Malar J) PubMed / full text
   more detail about this publication

microneme during schizont

Li, X., Chen, H., Oh, S. S., Chishti, A. H.
A Presenilin-like protease associated with Plasmodium falciparum micronemes is involved in erythrocyte invasion. (2008 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during merozoite
  • "Indirect immunofluorescence microscopy using specific antibodies showed PfSPP is co-localized with EBA-175 (a microneme protein), but neither with RAP1 (a rhoptry marker) nor MSP1 (merozoite surface protein) in the P. falciparum (3D7) schizonts."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during merozoite
  • Other genes localised in this publication: signal peptide peptidase, rhoptry-associated protein 1, merozoite surface protein 1

Haase, S., Cabrera, A., Langer, C., Treeck, M., Struck, N., Herrmann, S., Jansen, P. W., Bruchhaus, I., Bachmann, A., Dias, S., Cowman, A. F., Stunnenberg, H. G., Spielmann, T., Gilberger, T. W.
Characterization of a conserved rhoptry-associated leucine zipper-like protein in the malaria parasite Plasmodium falciparum. (2008 Mar, Infect Immun) PubMed / full text
   more detail about this publication

microneme and not rhoptry during extracellular merozoite and schizont
  • "The gene product of the cytoadherence-linked asexual gene 9 (clag9) (64) was used as a second rhoptry-specific marker. CLAG9 was previously localized exclusively to the bulb of the rhoptry (31). The distribution of CLAG9 predominantly overlaps with that of RALP1 (Fig. 5B). In contrast, the apical distribution of RALP1 was clearly distinct from that of the micronemal marker proteins EBA-175 and EBA-181 (19, 53) (Fig. 5C and D). Together, these findings establish RALP1 as a novel rhoptry-resident protein."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not rhoptry during schizont and free merozoite
  • Other genes localised in this publication: rhoptry-associated leucine zipper-like protein 1, cytoadherence linked asexual protein 9, erythrocyte binding antigen-181

Wickramarachchi, T., Devi, Y. S., Mohmmed, A., Chauhan, V. S.
Identification and characterization of a novel Plasmodium falciparum merozoite apical protein involved in erythrocyte binding and invasion. (2008, PLoS One) PubMed / full text
   more detail about this publication

apical end of surface during merozoite
  • "AMA1 was present over the entire surface of merozoites but is most densely distributed at the apical tip (Figure 5A), whereas EBA175 tends to be restricted to the apical end (Figure 5B) as shown earlier [8, [9."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical end of surface during merozoite
  • Other genes localised in this publication: asparagine-rich protein, merozoite surface protein 1, apical membrane antigen 1, cytoadherence linked asexual protein 3.2

Singh, S., Plassmeyer, M., Gaur, D., Miller, L. H.
Mononeme: a new secretory organelle in Plasmodium falciparum merozoites identified by localization of rhomboid-1 protease. (2007 Dec 11, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme

O'Donnell, R. A., Hackett, F., Howell, S. A., Treeck, M., Struck, N., Krnajski, Z., Withers-Martinez, C., Gilberger, T. W., Blackman, M. J.
Intramembrane proteolysis mediates shedding of a key adhesin during erythrocyte invasion by the malaria parasite. (2006 Sep 25, J Cell Biol) PubMed / full text
   more detail about this publication

microneme during schizont, apical and parasite plasma membrane during extracellular merozoite
  • "The punctate, apical pattern obtained with the latter is typical of microneme staining. (D) EBA-175 is discharged onto the apical surface of free merozoites. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during schizont, apical and surface during free merozoite
  • Other genes localised in this publication: rhomboid protease ROM4, merozoite surface protein 1

Treeck, M., Struck, N. S., Haase, S., Langer, C., Herrmann, S., Healer, J., Cowman, A. F., Gilberger, T. W.
A conserved region in the EBL proteins is implicated in microneme targeting of the malaria parasite Plasmodium falciparum. (2006 Oct 20, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "B, EBA-181tail (EBA-181 without the cytoplasmic domain) can be localized within the micronemes by using anti-EBA181 antibodies (green) and anti-EBA175 antibodies (red)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2mef
  • Gene model mapping comments: Taken directly from 16203726
  • Localisation record: microneme during schizont and free merozoite
  • Other genes localised in this publication: erythrocyte binding antigen-140, erythrocyte binding antigen-181

Pearce, J. A., Mills, K., Triglia, T., Cowman, A. F., Anders, R. F.
Characterisation of two novel proteins from the asexual stage of Plasmodium falciparum, H101 and H103. (2005 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during late schizont and schizont
  • "Double-labelling experiments appeared to show that H103 co-localised with known micronemal proteins, EBA175 and AMA1 (Fig. 3Ai and Aii), however further work is required to confirm this observation."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during schizont and mature schizont
  • Other genes localised in this publication: merozoite surface protein, apical membrane antigen 1, rhoptry-associated protein 1, merozoite surface protein 4

Healer, J., Crawford, S., Ralph, S., McFadden, G., Cowman, A. F.
Independent translocation of two micronemal proteins in developing Plasmodium falciparum merozoites. (2002 Oct, Infect Immun) PubMed / full text
   more detail about this publication

microneme during late schizont
  • "FIG. 2. Single and dual indirect immunofluorescence images showing the same subcellular localization of AMA1 and EBA-175 in two mature schizonts of P. falciparum. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 3D7
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during mature schizont
  • Other genes localised in this publication: merozoite surface protein 1

Blair, P. L., Kappe, S. H., Maciel, J. E., Balu, B., Adams, J. H.
Plasmodium falciparum MAEBL is a unique member of the ebl family. (2002 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during extracellular merozoite and late schizont

Kaneko, O., Mu, J., Tsuboi, T., Su, X., Torii, M.
Gene structure and expression of a Plasmodium falciparum 220-kDa protein homologous to the Plasmodium vivax reticulocyte binding proteins. (2002 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "Double staining with rabbit anti-EBA-175 serum or rabbit anti-Pf140-kDa rhoptry protein (PfRhopH2) serum showed the localization of PfRH4 was distinct from that of PfRhopH2, the authentic rhoptry protein, but undistinguishable from that of EBA-175, the authentic microneme protein (Fig. 2B) in schizonts and released merozoite"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during schizont and released merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: reticulocyte binding protein homologue 4, high molecular weight rhoptry protein 2

Thompson, J. K., Triglia, T., Reed, M. B., Cowman, A. F.
A novel ligand from Plasmodium falciparum that binds to a sialic acid-containing receptor on the surface of human erythrocytes. (2001 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "Subcellular localization of EBA140 suggests that it is located in the micronemes, the same localization as EBA175"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: D10, E12
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Microneme during schizont and free merozoite
  • Other genes localised in this publication: erythrocyte binding antigen-140

Triglia, T., Thompson, J., Caruana, S. R., Delorenzi, M., Speed, T., Cowman, A. F.
Identification of proteins from Plasmodium falciparum that are homologous to reticulocyte binding proteins in Plasmodium vivax. (2001 Feb, Infect Immun) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite
  • "EBA175 has been definitively localized to the micronemes, and IFA experiments with antibodies to PfR2Ha and EBA175 show that the two proteins do not exactly colocalize, suggesting that PfR2Ha is not located in the micronemes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: D10
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during free merozoite
  • Other genes localised in this publication: reticulocyte binding protein 2 homologue b, reticulocyte binding protein 2 homologue a, rhoptry-associated protein 1

Rayner, J. C., Vargas-Serrato, E., Huber, C. S., Galinski, M. R., Barnwell, J. W.
A Plasmodium falciparum homologue of Plasmodium vivax reticulocyte binding protein (PvRBP1) defines a trypsin-resistant erythrocyte invasion pathway. (2001 Dec 3, J Exp Med) PubMed / full text
   more detail about this publication

microneme during merozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.176 erythrocyte binding antigen-175
MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIFTFIENKLDILNNSKFNKRWK
SYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQNKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSNCRE
KRKGMKWDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGEISEHKIKNFRKKWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQI
TQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVPKENAENYLIK
ISENKNDAKVSLLLNNCDAEYSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPY
KLSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKIINKTFADIRDIIGGTDYW
NDLSNRKLVGKINTNSNYVHRNKQNDKLFRDEWWKVIKKDVWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQD
KTKMIETLKVECKEKPCEDDNCKRKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSN
LNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEESTEIAHRTETRTDERKNQEPANKDLKNPQQSVG
ENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLGKSDAIPNIGEPETGISTTEESRHEEGHNKQALSTSVDEPE
LSDTLQLHEDTKENDKLPLESSTITSPTESGSSDTEETPSISEGPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNL
LKLKGDVDISMPKAVIGSSPNDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSDNVQQSGGIVNMNVEKELK
DTLENPSSSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREGERTLTKEYEDIVLKSHMNRE
SDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQHIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLR
ESKESKIHKAEEERLSHTDIHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSERS
QINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKELIKKLAEINKCENEISVKYCD
HMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYYNCTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILG
ASQAKYQSSEGVMNENNENNFLFEVTDNLDKLSNMFNQQVQETNINDFSEYHEDINDINFKK

Gene-Specific Links for MAL7P1.176

General Sub-Cellular Localisation Links