ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.150 (IscS)

cysteine desulfurase, putative, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion and not apicoplast during schizont and trophozoite

Who localised this protein by microscopy?

Sato, S., Rangachari, K., Wilson, R. J.
Targeting GFP to the malarial mitochondrion. (2003 Aug 31, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast during schizont and trophozoite
  • "Counter-staining of transfectants with MTR showed that expression of GFP was localized to the mitochondrion (Fig. 2)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: mitochondria and not apicoplast during troph and schizont
  • Other genes localised in this publication: heat shock protein 60, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10425

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL7P1.150 cysteine desulfurase, putative
MKFLQIIKHLKLQNKKNALDNFVNCRTYEHISNINKLFLNNFSSTKEHSEHGQVKHENFLNSTLKYEENSQNGSTNNLKN
GKYNMYVSEGNVNINEEKYKDNNISSNNTQYNNNSSNSGSLNDEGPLWKEHIDDVVNENKKKKMNRFYLDSQATTMIDPR
VLDKMLPYMTYIYGNAHSRNHFFGWESEKAVEDARTNLLNLINGKNNKEIIFTSGATESNNLALIGICTYYNKLNKQKNH
IITSQIEHKCILQTCRFLQTKGFEVTYLKPDTNGLVKLDDIKNSIKDNTIMASFIFVNNEIGVIQDIENIGNLCKEKNIL
FHTDASQAAGKVPIDVQKMNIDLMSMSGHKLYGPKGIGALYIKRKKPNIRLNALIHGGGQERGLRSGTLPTHLIVGFGEA
AKVCSLEMNRDEKKVRYFFNYVKDYLTKHLDYIVFNGCQINRYYGNMNISFLFVEGESLLMSLNEIALSSGSACTSSTLE
PSYVLRSIGISEDIAHTSIRIGFNRFTTFFEVQQLCINLVKSVERLRSISPLYEMELEKKNPSNDDIPKFIWT

Gene-Specific Links for MAL7P1.150

General Sub-Cellular Localisation Links