ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL7P1.119 (RALP1)

rhoptry-associated leucine zipper-like protein 1, a gene from Plasmodium falciparum

Compiled localisation
apical during extracellular merozoite and schizont

Who localised this protein by microscopy?

Haase, S., Cabrera, A., Langer, C., Treeck, M., Struck, N., Herrmann, S., Jansen, P. W., Bruchhaus, I., Bachmann, A., Dias, S., Cowman, A. F., Stunnenberg, H. G., Spielmann, T., Gilberger, T. W.
Characterization of a conserved rhoptry-associated leucine zipper-like protein in the malaria parasite Plasmodium falciparum. (2008 Mar, Infect Immun) PubMed / full text
   more detail about this publication

apical during extracellular merozoite and schizont
  • "The gene product of the cytoadherence-linked asexual gene 9 (clag9) (64) was used as a second rhoptry-specific marker. CLAG9 was previously localized exclusively to the bulb of the rhoptry (31). The distribution of CLAG9 predominantly overlaps with that of RALP1 (Fig. 5B). In contrast, the apical distribution of RALP1 was clearly distinct from that of the micronemal marker proteins EBA-175 and EBA-181 (19, 53) (Fig. 5C and D). Together, these findings establish RALP1 as a novel rhoptry-resident protein."
  • Microscopy type: Light
  • Microscopy method: GFP tag, C terminal Ty1 tag, antibody
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper, length matches, annotation doesn't match
  • Localisation record: apical during schizont and free merozoite
  • Other genes localised in this publication: cytoadherence linked asexual protein 9, erythrocyte binding antigen-175, erythrocyte binding antigen-181

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42779

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL7P1.119 rhoptry-associated leucine zipper-like protein 1
MNFFFFFIIVYCFISSFYLIKSSSNDKNKINKNNMPLQRGASNLKDINIHNVEKKSNMESVNNNINNTTCSKNLNANKVP
NVAHTGVNKKGETKNEEVEKEENENEEIEKEEIENEENQQNEEDENEENQQNEEDENEENQQMNVNVDVSAEKKNKELPE
EKKELQKNSEKNINKEVIKDSNKDNTFNFHKNINTSFNKNKNIYNNNNNNNNNNKTFIEKKEEAIDMKKTHCSNNNKMCK
YNNMNNHMSTNKNNNQIFEESKQNVNKPIYNLKSLGNNTFKNDEKYNENDYKNNHDDDKKKYTDDSNEENIYEERNQKIL
LIHLLKNIKELLNRQRQNFNNFLSFLSENYQSYEKFYKSQKYQNGKNYIDKLDQQGELKNVSVVTHSFLDMSKAANGKKD
KNGVFVKLMNDQNDDGDDTKDGDDTKDEDDHKNEDDHKNEDDHKNEDDHKNEDDHKNGDDNKNGDDHKNGDDNKNGDDDN
GKKSHDISDIKNIIDTILQSDDITDEQKKYLEIIKKILDLEEDVLNKEKEQLQLNKNIIEVLMGKSDELRNIAVNLKNGN
GDNESSQRVDLAQNIVSNLLNFSVQLKNTGNIVYNNIQGQGELLQSIEKNIDKAENDLKKSTSVNTTFTPKNVPNTEQND
QETQTDDDINDSDIDENNNTNDKNNCHMYKKNNCHMYKKNNCKKYFLNSHYNNYLCKKQKKYNKNDMGNKQKDNKKFKLN
ESMKNHFYNIFVKETVMLKKLYKVLFELF

Gene-Specific Links for MAL7P1.119

General Sub-Cellular Localisation Links