ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.61 ()

Plasmodium exported protein (hyp8), unknown function, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and nucleus during intraerythrocytic

Who localised this protein by microscopy?

Hossain, M. J., Korde, R., Singh, P. K., Kanodia, S., Ranjan, R., Ram, G., Kalsey, G. S., Singh, R., Malhotra, P.
Plasmodium falciparum Tudor Staphylococcal Nuclease interacting proteins suggest its role in nuclear as well as splicing processes. (2010 Nov 15, Gene) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intraerythrocytic

Orthology

OrthoMCL

Part of OrthoMCL group OG4_118683

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL13P1.61 Plasmodium exported protein (hyp8), unknown function
MSFCYVRTISIALFLFIFLFLNNGNFKNNFYRKDNKYSSIKIRSFRSLAENQKVETEQSTPAKPEPTEFVNNDIHQNKNT
FKKLKNNEKKKEILEEKMKDFVKLYVNKSSGECQRYRLQQHLKNYSSSNEYKKFMNKFVKFLKVHNDLNALKSQLHFNNV
RAATIIFIAGFLSIFAILLTISAVAATSKFTNNMLAIAGVGALGSALSLPGMALLFVPAMLYVLNRKNEITNHYSERIIK
QVSNF

Gene-Specific Links for MAL13P1.61

General Sub-Cellular Localisation Links