ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.60 (EBA140, EBA-140, BAEBL)

erythrocyte binding antigen-140, a gene from Plasmodium falciparum

Compiled localisation
microneme during extracellular merozoite and late schizont and schizont and segmenter
not rhoptry during extracellular merozoite and late schizont

Who localised this protein by microscopy?

Treeck, M., Struck, N. S., Haase, S., Langer, C., Herrmann, S., Healer, J., Cowman, A. F., Gilberger, T. W.
A conserved region in the EBL proteins is implicated in microneme targeting of the malaria parasite Plasmodium falciparum. (2006 Oct 20, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "Truncation of the cytoplasmic domain of both EBA-181 and EBA-140 does not interfere with microneme localization of either protein (Fig. 2, A and B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: W2mef
  • Gene model mapping comments: annotation matches
  • Localisation record: microneme during schizont and free merozoite
  • Other genes localised in this publication: erythrocyte binding antigen-175, erythrocyte binding antigen-181

Blair, P. L., Kappe, S. H., Maciel, J. E., Balu, B., Adams, J. H.
Plasmodium falciparum MAEBL is a unique member of the ebl family. (2002 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and not rhoptry during extracellular merozoite and late schizont

Thompson, J. K., Triglia, T., Reed, M. B., Cowman, A. F.
A novel ligand from Plasmodium falciparum that binds to a sialic acid-containing receptor on the surface of human erythrocytes. (2001 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during extracellular merozoite and schizont
  • "Subcellular localization of EBA140 suggests that it is located in the micronemes, the same localization as EBA175"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: D10, E12
  • Gene model mapping comments: Taken directly from 17553576, annotation matches
  • Localisation record: Microneme during schizont and free merozoite
  • Other genes localised in this publication: erythrocyte binding antigen-175

Adams, J. H., Blair, P. L., Kaneko, O., Peterson, D. S.
An expanding ebl family of Plasmodium falciparum. (2001 Jun, Trends Parasitol) PubMed / full text
   more detail about this publication

microneme during segmenter
  • "Despite the apparent complete colocalization of EBL-1-specific antibodies with RAP1 and partial colocalization with BAEBL antibodies, the differentiation between micronemes and rhoptries is not possible by confocal microscopy because of its limited resolution."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during fully mature merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: A common gene for all genes not assigned to a gene model, rhoptry-associated protein 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL13P1.60 erythrocyte binding antigen-140
MKGYFNIYFLIPLIFLYNVIRINESIIGRTLYNRQDESSDISRVNSPELNNNHKTNIYDSDYEDVNNKLINSFVENKSVK
KKRSLSFINNKTKSYDIIPPSYSYRNDKFNSLSENEDNSGNTNSNNFANTSEISIGKDNKQYTFIQKRTHLFACGIKRKS
IKWICRENSEKITVCVPDRKIQLCIANFLNSRLETMEKFKEIFLISVNTEAKLLYNKNEGKDPSIFCNELRNSFSDFRNS
FIGDDMDFGGNTDRVKGYINKKFSDYYKEKNVEKLNNIKKEWWEKNKANLWNHMIVNHKGNISKECAIIPAEEPQINLWI
KEWNENFLMEKKRLFLNIKDKCVENKKYEACFGGCRLPCSSYTSFMKKSKTQMEVLTNLYKKKNSGVDKNNFLNDLFKKN
NKNDLDDFFKNEKEYDDLCDCRYTATIIKSFLNGPAKNDVDIASQINVNDLRGFGCNYKSNNEKSWNCTGTFTNKFPGTC
EPPRRQTLCLGRTYLLHRGHEEDYKEHLLGASIYEAQLLKYKYKEKDENALCSIIQNSYADLADIIKGSDIIKDYYGKKM
EENLNKVNKDKKRNEESLKIFREKWWDENKENVWKVMSAVLKNKETCKDYDKFQKIPQFLRWFKEWGDDFCEKRKEKIYS
FESFKVECKKKDCDENTCKNKCSEYKKWIDLKKSEYEKQVDKYTKDKNKKMYDNIDEVKNKEANVYLKEKSKECKDVNFD
DKIFNESPNEYEDMCKKCDEIKYLNEIKYPKTKHDIYDIDTFSDTFGDGTPISINANINEQQSGKDTSNTGNSETSDSPV
SHEPESDAAINVEKLSGDESSSETRGILDINDPSVTNNVNEVHDASNTQGSVSNTSDITNGHSESSLNRTTNAQDIKIGR
SGNEQSDNQENSSHSSDNSGSLTIGQVPSEDNTQNTYDSQNPHRDTPNALASLPSDDKINEIEGFDSSRDSENGRGDTTS
NTHDVRRTNIVSERRVNSHDFIRNGMANNNAHHQYITQIENNGIIRGQEESAGNSVNYKDNPKRSNFSSENDHKKNIQEY
NSRDTKRVREEIIKLSKQNKCNNEYSMEYCTYSDERNSSPGPCSREERKKLCCQISDYCLKYFNFYSIEYYNCIKSEIKS
PEYKCFKSEGQSSIPYFAAGGILVVIVLLLSSASRMGKSNEEYDIGESNIEATFEENNYLNKLSRIFNQEVQETNISDYS
EYNYNEKNMY

Gene-Specific Links for MAL13P1.60

General Sub-Cellular Localisation Links