ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.56 (A-M1)

M1-family alanyl aminopeptidase, a gene from Plasmodium falciparum

Compiled localisation
food vacuole and intracellular and not food vacuole and nucleus

Who localised this protein by microscopy?

Azimzadeh, O., Sow, C., Geze, M., Nyalwidhe, J., Florent, I.
Plasmodium falciparum PfA-M1 aminopeptidase is trafficked via the parasitophorous vacuole and marginally delivered to the food vacuole. (2010, Malar J) PubMed / full text
   more detail about this publication

intracellular and not food vacuole
  • "In the control culture, exp-2 was targeted as expected to the PVM and PfA-M1 was diffuse in the parasite (but outside the FV) as previously shown [4]."
  • Microscopy type: Fixed Light
  • Microscopy method: antibody directly to protein
  • Strain: FCBR
  • Gene model mapping comments: inferred from another publication
  • Localisation record: diffuse in parasite and not FV
  • Comment: stage information not found in publication
  • Other genes localised in this publication: exported protein 2

Dalal, S., Klemba, M.
Roles for two aminopeptidases in vacuolar hemoglobin catabolism in Plasmodium falciparum. (2007 Dec 7, J Biol Chem) PubMed / full text
   more detail about this publication

food vacuole and nucleus
  • "Table 1: Localisation: FV, Nuc … Interestingly, both of these APs also accumulated in a second compartment as follows: the cytosol (PfAPP) and the nucleus (PfA-M1)."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: 3D7
  • Gene model mapping comments: Taken directly from paper
  • Localisation record: FV, Nucleus
  • Comment: strain information not found
  • Other genes localised in this publication: M17 leucyl aminopeptidase, aminopeptidase P, M18 aspartyl aminopeptidase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13832

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.56 M1-family alanyl aminopeptidase
MKLTKGCAYKYIIFTVLILANILYDNKKRCMIKKNLRISSCGIISRLLKSNSNYNSFNKNYNFTSAISELQFSNFWNLDI
LQKDIFSNIHNNKNKPQSYIIHKRLMSEKGDNNNNNHQNNNGNDNKKRLGSVVNNEENTCSDKRMKPFEEGHGITQVDKM
NNNSDHLQQNGVMNLNSNNVENNNNNNSVVVKKNEPKIHYRKDYKPSGFIINNVTLNINIHDNETIVRSVLDMDISKHNV
GEDLVFDGVGLKINEISINNKKLVEGEEYTYDNEFLTIFSKFVPKSKFAFSSEVIIHPETNYALTGLYKSKNIIVSQCEA
TGFRRITFFIDRPDMMAKYDVTVTADKEKYPVLLSNGDKVNEFEIPGGRHGARFNDPHLKPCYLFAVVAGDLKHLSATYI
TKYTKKKVELYVFSEEKYVSKLQWALECLKKSMAFDEDYFGLEYDLSRLNLVAVSDFNVGAMENKGLNIFNANSLLASKK
NSIDFSYARILTVVGHEYFHNYTGNRVTLRDWFQLTLKEGLTVHRENLFSEEMTKTVTTRLSHVDLLRSVQFLEDSSPLS
HPIRPESYVSMENFYTTTVYDKGSEVMRMYLTILGEEYYKKGFDIYIKKNDGNTATCEDFNYAMEQAYKMKKADNSANLN
QYLLWFSQSGTPHVSFKYNYDAEKKQYSIHVNQYTKPDENQKEKKPLFIPISVGLINPENGKEMISQTTLELTKESDTFV
FNNIAVKPIPSLFRGFSAPVYIEDNLTDEERILLLKYDSDAFVRYNSCTNIYMKQILMNYNEFLKAKNEKLESFNLTPVN
AQFIDAIKYLLEDPHADAGFKSYIVSLPQDRYIINFVSNLDTDVLADTKEYIYKQIGDKLNDVYYKMFKSLEAKADDLTY
FNDESHVDFDQMNMRTLRNTLLSLLSKAQYPNILNEIIEHSKSPYPSNWLTSLSVSAYFDKYFELYDKTYKLSKDDELLL
QEWLKTVSRSDRKDIYEILKKLENEVLKDSKNPNDIRAVYLPFTNNLRRFHDISGKGYKLIAEVITKTDKFNPMVATQLC
EPFKLWNKLDTKRQELMLNEMNTMLQEPNISNNLKEYLLRLTNKL

Gene-Specific Links for MAL13P1.56

General Sub-Cellular Localisation Links