ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.348 (GAA1)

glycosylphosphatidylinositol anchor attachment 1 protein, putative, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum

Who localised this protein by microscopy?

Delorenzi, M., Sexton, A., Shams-Eldin, H., Schwarz, R. T., Speed, T., Schofield, L.
Genes for glycosylphosphatidylinositol toxin biosynthesis in Plasmodium falciparum. (2002 Aug, Infect Immun) PubMed / full text
   more detail about this publication

endoplasmic reticulum

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29580

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL13P1.348 glycosylphosphatidylinositol anchor attachment 1 protein, putative
MGFSENPKFCLLINKLIKKSKVIGVFLSIIGVIFFLVFNKFNKNAELDARTFTQFVGNSVLNKKNEKFYNDTNSYFMNYT
YEGKEDIIKLIYDYIRKNILVNVENEMVKIKLTDRIEQNILISNVGCKYCNNMESLVVVINFDFKERKYFHSVIIGLTLM
EHFSKCNYMSKDVTFLFTNKELLYSLGVQEFIQKYFYNNTNRIGKKIIRSSTIIEFDSIYPSYIKINYEGLNGMLPNQDL
ILLLTNELHFYSIPIKMELTHGSIFDMALEKNYENGHIYFLRENIPAFTATGGSKVPIRNKMINLFNLTKALQSYLRSQS
NTHEGFCHSSNFYFFNTFRRHIPISIYCYSVYLICAYSIMKLFKSTIFRSYINFLTGFYTYLITILIISLPIYLISTNKK
FYELLNFEENYIPSCYEWHPDNFDKYIKIANIWWNVLFFSIFGAFFFNLFISFLVNKKRKVIPKKNDQNESFDGYKKVEK
VERILILEKIKELQNEIMKRKGITNNHNNIKNYNIYTNENIYNNNINNINNNNNIYENLYDNGEVKKNILVKPKIINSDD
EDFLLEKKNSEFIKKIEKQIEILEEKLEFLSNDENVKYIFYNNSIAPFNTMMIYMNIFYFILVALLSSLYNWSYSVLFSL
LFVIPISILHNLKTKPVRIFKKIILSLFILCMFIYMYPNDNHLWNIRQKLTNLFRNNISKCCKYLDKHKILQSKYFPESL
QFICSNRLFDSFYSNKYFLDNLNIKFSYVLDIQNGFLLTLYNLARNHFCIGTATYPLICFTLFPIVFYIVFLFFC

Gene-Specific Links for MAL13P1.348

General Sub-Cellular Localisation Links