ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.326 (FC, HemH)

ferrochelatase, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion and near apicoplast membranes and not apicoplast and not mitochondrion

Who localised this protein by microscopy?

Nagaraj, V. A., Prasad, D., Rangarajan, P. N., Padmanaban, G.
Mitochondrial localization of functional ferrochelatase from Plasmodium falciparum. (2009 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast
  • "PfFC clearly co-localizes with PfHSP60 (mitochondrial marker) and not with PfPBGD (apicoplast marker)."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Mitochondria and not apicoplast
  • Comment: alternate splicing Haven't got access to the needed supplementary material yet. This result negates previous publications inferring apicoplast localisation of FC
  • Other genes localised in this publication: heat shock protein 60, porphobilinogen deaminase

van Dooren, G. G., Stimmler, L. M., McFadden, G. I.
Metabolic maps and functions of the Plasmodium mitochondrion. (2006 Jul, FEMS Microbiol Rev) PubMed / full text
   more detail about this publication

mitochondrion and not apicoplast

Varadharajan, S., Sagar, B. K., Rangarajan, P. N., Padmanaban, G.
Localization of ferrochelatase in Plasmodium falciparum. (2004 Dec 1, Biochem J) PubMed / full text
   more detail about this publication

near apicoplast membranes and not mitochondrion
  • "However, PfFC is not localized to the parasite mitochondrion. Immunoelectron-microscopy studies reveal that PfFC is indeed localized to the apicoplast, whereas hFC is distributed in the parasite cytoplasm."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: Blast from AJ300470, annotation matches
  • Localisation record: Close to membrane in apicoplast and not mitochondria
  • Comment: stage information not found in publication
  • Comment: strain information not found
  • Other genes localised in this publication: heat shock protein 60

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10964

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.326 ferrochelatase
MDVQDFLNCNKLKISKEKISNLNKSKIGILITNLGSPEKLTYWSLYKYLSEFLTDPRVVKLNRFLWLPILYTFVLPFRSG
KVLSKYKSIWIKDGSPLCVNTHNQCLALKKILNEKYNNKVVISYGMRYGERSIKKGLEYLQKENINKLLVLPLYPQSAEC
TVSSTLDCIGKNLKNWSNVPELRFISGYCLKDIFINTMKENIENYWELYGKSKKLIISYHSLPIRNVIQGDLYPFFCIES
TKKLVKSLNLNKDDYILVFQSKIKGQQWVKPCIEDTIIRLAKQGYKQIDIVSPSFSSDCLETLEEIKIHYQQLFRKYSNG
NLRYINCLNDTTIGIKLIMNLIEQNIIGWV

Gene-Specific Links for MAL13P1.326

General Sub-Cellular Localisation Links