ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.274 (PP5)

serine/threonine protein phosphatase, a gene from Plasmodium falciparum

Compiled localisation
cytoplasm and nucleus during gametocyte and ring and trophozoite

Who localised this protein by microscopy?

Lindenthal, C., Klinkert, M. Q.
Identification and biochemical characterisation of a protein phosphatase 5 homologue from Plasmodium falciparum. (2002 Apr 9, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during gametocyte and ring and trophozoite
  • "Most notably, protein PfPP5 appears to be concentrated in the nucleus, as evidenced by its colocalisation in nuclear material as counterstained with the dye DAPI. However, the protein is also detectable in the cytoplasm of P. falciparum although in a lower concentration."
  • Microscopy type: Fixed light
  • Microscopy method: polyclonal antibody to recombinantly expressed protein
  • Strain: Binh1
  • Gene model mapping comments: blast from AF404815, inconsistent gene model?
  • Localisation record: concentrated in nucleus and lower concentration in cytoplasm during rings and trophozoites and gametocytes
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11778

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_113190 serine/threonine protein phosphatase, putative
  • PY04697 serine/threonine protein phosphatase PP5
  • PVX_114750 serine/threonine protein phosphatase PP5, putative
  • PKH_111550 serine/threonine protein phosphatase, putative
  • TGME49_112200 serine/threonine protein phosphatase, putative
  • NCLIV_055800 Serine/threonine protein phosphatase 5 (EC 3.1.3.16), related
  • cgd2_2960 phosphoprotein phosphatase related, putative
  • Chro.20310 phosphoprotein phosphatase -related
  • CMU_030510 serine/threonine protein phosphatase, putative
  • TP02_0944 serine/threonine protein phosphatase, putative
  • TA15975 serine/threonine protein phosphatase, putative
  • BBOV_IV000160 serine/threonine protein phosphatase 5
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.274 serine/threonine protein phosphatase
MVIVTEKINNNVKIEDNNINRFEEDMDKNVDEDNETIYKINEEKVNICNNIEKEHNQKEDKENVMLNNHNVEEEEDIKKT
DEVLMNDEKIKNDFHLEIGEYSKNHKCDDPLNNNKTDHCDKERKDICLELLKTCDALKNIGNKYFKENNYIISLRYYTEA
IDLIKKSFEQCPNNVTDIDNENNTNNLHDDVEVDDEDKELFKEYYNKSAISKKSDFISIKETDLHIYYTNRSFCHIKLEN
YGTAIEDIDEAIKINPYYAKAYYRKGCSYLLLSDLKRASECFQKVLKLTKDKNSELKLKQCKKLIFEQQFQKAIELEQKM
PYYETLVLDSLKIENMEAPIYDRNNLNLDFLKKVADYISIPNNKLNKKCVCAIVLDVIKLLKELPTLVYLNLEEDETLTI
CGDVHGQYYDLLNIMKINGYPSEKNSYLFNGDFVDRGSFSVEVIIFLYLAKLTFPNNVYLTRGNHETDNMNKIYGFLGEL
QEKYDEKMHVLFSDSFKFLPLAYVLNKNIFICHGGIPSKTDTTLEDIEKIDRNKEPLDEGVMTDLLWSDPNEEKGFKPSK
RGIGFSFGTDITENFLKINNLSLIIRSHEVRDEGYSLEQNGQLYTVFSAPNYCDIMKNKGAFLKFKGNSIKPECVTFTEV
EHPNVPSLKYAHNLYQNI

Gene-Specific Links for MAL13P1.274

General Sub-Cellular Localisation Links