ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.231 (Sec61)

Sec61 alpha subunit, PfSec61, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during ring and schizont and trophozoite

Who localised this protein by microscopy?

Couffin, S., Hernandez-Rivas, R., Blisnick, T., Mattei, D.
Characterisation of PfSec61, a Plasmodium falciparum homologue of a component of the translocation machinery at the endoplasmic reticulum membrane of eukaryotic cells. (1998 Apr 1, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during ring and schizont and trophozoite
  • "Immunofluorescence confocal microscopy showed that PfSec61 was located in the parasite cytoplasm, close to the nucleus, in a position consistent with its being in the endoplasmic reticulum."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Palo Alto Uganda
  • Gene model mapping comments: Blast from AF006204.1, annotation matches
  • Localisation record: ER during ring and schizont and troph
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10575

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.231 Sec61 alpha subunit, PfSec61
MVRFLNLIKPVMFLLPEVQSPDRKLPFKEKLLWTAVSLFVFLICCQIPLYGIVTSKSSDPFYWMRVILASNRGTLMELGI
SPIVTSGMVMQLLAGSKIIDVDQSLKEDRTLFQGAQKLLGLLITLGEAIAYVISGIYGNISEIGTGHAIIIILQLFFAGV
VVILLDELLQKGYGLGSGISLFIATNICETIMWKSFSPTTINTDKGIEFEGAIISLIYCLFTESNKISALKKAFYRTHAP
NVTNLLATILVFLIVIYLQGFRVDLSVKYQSVRGQQGTYPIKLFYTSNIPIILQTALVSNLYFFSQILYKRFKNSILVNL
LGQWQEVESSGTSIPIGGLAYYISPPNSFADITNDPFHTLVYISFVLVACAFFSKTWIEVSGSSAKDVAKQLRDQQIGMR
GFRDTPTSLTRVFNRYIPTAAAFGGMCIGALTILADFLGALGSGTGILLAVTIIYQFYEMLVKEQEKAASLF

Gene-Specific Links for MAL13P1.231

General Sub-Cellular Localisation Links