ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.225 (Trx2)

thioredoxin 2, a gene from Plasmodium falciparum

Compiled localisation
mitochondrion during trophozoite

Who localised this protein by microscopy?

Boucher, I. W., McMillan, P. J., Gabrielsen, M., Akerman, S. E., Brannigan, J. A., Schnick, C., Brzozowski, A. M., Wilkinson, A. J., Muller, S.
Structural and biochemical characterization of a mitochondrial peroxiredoxin from Plasmodium falciparum. (2006 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

mitochondrion during trophozoite
  • "We have analysed the biochemical and structural features of the mitochondrial peroxiredoxin and thioredoxin of P. falciparum. The mitochondrial localization of both proteins was confirmed by expressing green fluorescent protein fusions in parasite erythrocytic stages."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain:
  • Gene model mapping comments: Blast from AAQ05974, annotation matches
  • Localisation record: Mitochondria during troph
  • Comment: strain information not found
  • Other genes localised in this publication: thioredoxin peroxidase 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37652

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL13P1.225 thioredoxin 2
MKKYIFFFLFSFINFFFVYDVTCTKEVTSTNDDPLTPLNRFDKYYLRMFKKVPRLQQNGSNIINGVNMKNTVIVLYFFAK
WCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKHL

Gene-Specific Links for MAL13P1.225

General Sub-Cellular Localisation Links