ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.220 (LipA)

lipoate synthase, putative, a gene from Plasmodium falciparum

Compiled localisation
apicoplast during late trophozoite and ring and segmenter and trophozoite

Who localised this protein by microscopy?

Wrenger, C., Muller, S.
The human malaria parasite Plasmodium falciparum has distinct organelle-specific lipoylation pathways. (2004 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

apicoplast during late trophozoite and ring and segmenter and trophozoite
  • "The localization of P. falciparum LipA was investigated by expressing a fusion of the 119 N-terminal amino acids of LipA and green fluorescent protein (GFP) in P. falciparum erythrocytic stages. This protein localized to a single organelle within the parasites that was clearly distinct from the mitochondrion"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: 3D7
  • Gene model mapping comments: Blast from NP_705332, annotation matches
  • Localisation record: Apicoplast during ring and troph and old trophozoite and segmenter
  • Other genes localised in this publication: lipoate protein ligase a type 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10835

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.220 lipoate synthase, putative
MHFGIPSLFYLYILFSIIMRIKCVITKNLKKTKKRTCSYIPHGNMEKGIILNYIEKPNPAYLKRGKNKNKNKNKKGDIYK
LRNVEILLYANRYVHEGNENFSSTTKKLLLTPKVGNKMPEGKKPDWFHVAAPTVAKYNKLKDDIKKLNLHTVCEEAQCPN
IGECWNIGTATIMLLGDTCTRGCKFCSIKTSSNPLPPDINEPFNTAKAICEWNIDYVVLTSVDRDDLPDGGASHFAKTVE
LVKFSRPDILIECLVSDFQGNIDSVRKLAFSGLDVYAHNIETVKRLQKYVRDKRANYDQSLFVLKTAKEINPQLYTKTSI
MLGLGETKEEVIQTMYDARKNNIDVITFGQYLRPTKNHLSIVQYISPQMFEYYKEEGLKMGFKYIASGPLVRSSYKAGEY
FIKNLVNQRNKDKKN

Gene-Specific Links for MAL13P1.220

General Sub-Cellular Localisation Links