ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.214 (pmt) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

phosphoethanolamine N-methyltransferase, a gene from Plasmodium falciparum

Compiled localisation
golgi apparatus and not cytosol and not endoplasmic reticulum during ring and schizont and trophozoite

Who localised this protein by microscopy?

Witola, W. H., Pessi, G., El Bissati, K., Reynolds, J. M., Mamoun, C. B.
Localization of the phosphoethanolamine methyltransferase of the human malaria parasite Plasmodium falciparum to the Golgi apparatus. (2006 Jul 28, J Biol Chem) PubMed / full text
   more detail about this publication

golgi apparatus and not cytosol and not endoplasmic reticulum during ring and schizont and trophozoite
  • "Colocalization studies using anti-Pfpmt affinity-purified polyclonal antibodies and an anti-GFP monoclonal antibody confirmed that the native Pfpmt is not cytoplasmic (Fig. 5A), showing only partial overlap with BiP (Fig. 5B), but revealed a complete colocalization with Rab6-GFP (Fig. 5C), thus demonstrating that Pfpmt resides in the Golgi apparatus of the parasite."
  • Microscopy type: Light, EM
  • Microscopy method: GFP tag, polyclonal antibody directly to protein epitopes LDDGWSRKIKDSKRKMQR and SSGGLEATKKILSDIELN
  • Strain: 3D7
  • Gene model mapping comments: Blast from AY429590, gene model inconsistent
  • Localisation record: Golgi and not ER and not cytosol during ring and troph and schizont
  • Other genes localised in this publication: protein phosphatase 2c, heat shock protein 70, Rab GTPase 6

Orthology

OrthoMCL

Part of OrthoMCL group OG4_15500

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_083045 phosphoethanolamine N-methyltransferase, putative
  • PKH_121150 phosphoethanolamine N-methyltransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.214 phosphoethanolamine N-methyltransferase
MTLIENLNSDKTFLENNQYTDEGVKVYEFIFGENYISSGGLEATKKILSDIELNENSKVLDIGSGLGGGCMYINEKYGAH
THGIDICSNIVNMANERVSGNNKIIFEANDILTKEFPENNFDLIYSRDAILHLSLENKNKLFQKCYKWLKPTGTLLITDY
CATEKENWDDEFKEYVKQRKYTLITVEEYADILTACNFKNVVSKDLSDYWNQLLEVEHKYLHENKEEFLKLFSEKKFISL
DDGWSRKIKDSKRKMQRWGYFKATKN

Gene-Specific Links for MAL13P1.214

General Sub-Cellular Localisation Links