ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.206 (PiT)

sodium-dependent phosphate transporter, a gene from Plasmodium falciparum

Compiled localisation
parasite plasma membrane during intraerythrocytic

Who localised this protein by microscopy?

Saliba, K. J., Martin, R. E., Broer, A., Henry, R. I., McCarthy, C. S., Downie, M. J., Allen, R. J., Mullin, K. A., McFadden, G. I., Broer, S., Kirk, K.
Sodium-dependent uptake of inorganic phosphate by the intracellular malaria parasite. (2006 Oct 5, Nature) PubMed / full text
   more detail about this publication

parasite plasma membrane during intraerythrocytic
  • "PfPiT localizes to the parasite surface, colocalizing with PfENT1 (red), a transport protein shown previously to reside on the plasma membrane of the parasite14."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: FAF-6
  • Gene model mapping comments: Blast from AJ580003, annotation matches
  • Localisation record: parasite surface during asexual
  • Other genes localised in this publication: nucleoside transporter 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10180

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.206 sodium-dependent phosphate transporter
MVTGPDMLWLVITSGIACFFMAFVTGANDIANTFSTSIGSKAISIKKALIVAFFFEALGASLLGGTVTDSIRSKIINFQV
FYDTPEFLMLGMCCALMGATVWLAVATRAGLPVSTTHSIIGALLGFGLATGNMKSIKWEKINNIVISWLAAPILAGTCSA
IAFTVLRMLILRKKNSFEIIKKMYWFLIFLITLPFSVFLIFHNPIVINTQCKMKKDGKVIVSSPCYIEDWSAAHSFYASI
ICILLSSLLTAIGSFVIYIIYNKRINNYNLKKKIFCEELADIEKNPQNNFCAINNSSLNSVASNETQLTQAHNNTSNGTK
QNQVGNGTKSNNNNVLVLPGDKNVKSQQDDSKTNGTQKTGSVEAHHVVHIKDNGSEDKSHENMLKKNLDKVTNMNENNNN
SNKNNNSNKNNNSNKNNNSNKNNNSNKNNNSNKNNNSNKNNNSNNGNSNEGNGKGGDPKNMENVIIENFDPQTEIVFSSL
QIISAILGVVAQSANDTANAIGPFAAVFNTYNNGIRGKIKVQWYILLFGGLSMSLGLSIMGYRVIKTVGMKLIKITPARG
FTIELISGLVVLFFSICGIPLSSTHCAVSSVIGLGLVEAKMNADNKRHARKSMDKDIIQVDKDKSFTLTEKIKYPFSFLN
TSCVNLRLFRTVFLSWILTVVFSATVTAGIYSFAAYSPSYIMKMQTV

Gene-Specific Links for MAL13P1.206

General Sub-Cellular Localisation Links