ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.169 (Syn5p)

syntaxin, Qa-SNARE family, a gene from Plasmodium falciparum

Compiled localisation
cis-golgi and endoplasmic reticulum during trophozoite

Who localised this protein by microscopy?

Ayong, L., Pagnotti, G., Tobon, A. B., Chakrabarti, D.
Identification of Plasmodium falciparum family of SNAREs. (2007 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cis-golgi and endoplasmic reticulum during trophozoite
  • "As indicated by blue arrowheads, the fusion protein GFP-PfSyn5p (green) co-localizes with the cis-Golgi marker PfERD2 (red, panel a) and with the ER marker PfBip (red, panel b)"
  • Microscopy type: Light
  • Microscopy method: GFP
  • Strain: 3D7
  • Gene model mapping comments: Blast from DQ649424, annotation matches
  • Localisation record: ER and cis Golgi during trophozoite
  • Other genes localised in this publication: SNARE protein, ER lumen protein retaining receptor, heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11472

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.169 syntaxin, Qa-SNARE family
MPYVDKTEEFFKIIEKLSNDNINIRKNRSIVQDTQVGELASKITDLLQSGYQKLQQLERCVKQKGIFNDKTSEIEELTYE
VKQTITDVTNELDLLVQYSCNLNISNPQSKTHIDNIISSLKNRLFDFTKKFKDVLQIRSEHIKKQVNRRKMYSYTSNEAT
FNNDNYKFTPLGDIDIESGQQQVLKQPSKHSYLHSRADAMENIQKVIGDLAQMFQKVATMVTQQDEMIKRIDEDIDISLT
NTREGQNYLLTYFNRLTSTRTLILQIFACIFILIVFFVIFS

Gene-Specific Links for MAL13P1.169

General Sub-Cellular Localisation Links