ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.167 (SP21)

signal peptidase 21 kDa subunit, a gene from Plasmodium falciparum

Compiled localisation
endoplasmic reticulum during intraerythrocytic

Who localised this protein by microscopy?

Tuteja, R., Pradhan, A., Sharma, S.
Plasmodium falciparum signal peptidase is regulated by phosphorylation and required for intra-erythrocytic growth. (2008 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

endoplasmic reticulum during intraerythrocytic
  • "The results show some background staining of the erythrocyte cytoplasm but the overlap of the more intense staining in the parasite cytoplasm is consistent with an ER location (Fig. 4A (vi)). "
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: 3D7
  • Gene model mapping comments: taken directly from paper, blast from DQ286434, annotation matches
  • Localisation record: ER during asexual
  • Other genes localised in this publication: heat shock protein 70

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10864

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.167 signal peptidase 21 kDa subunit
MDFIKEQYNSLVLDLRKTFRNKRDGLSHILNVICLLLNALMIWKLLVVFTGCESPVVVVLSGSMEPGYYRGDTLALYHPP
KIHAGDVVVYQINGRDIPIVHRILSLHTSKDNKFHLLSKGDNNNIDDRGLYDPHQYWLENEHVLGLSVGYTPYIGILTIW
INEYPVVKWAIVSIMLIMILMGYE

Gene-Specific Links for MAL13P1.167

General Sub-Cellular Localisation Links