ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.130 (GAPM1)

glideosome associated protein with multiple membrane spans 1, a gene from Plasmodium falciparum

Compiled localisation
inner membrane complex during early schizont and extracellular merozoite and late schizont
not parasite plasma membrane during early schizont

Who localised this protein by microscopy?

Hu, G., Cabrera, A., Kono, M., Mok, S., Chaal, B. K., Haase, S., Engelberg, K., Cheemadan, S., Spielmann, T., Preiser, P. R., Gilberger, T. W., Bozdech, Z.
Transcriptional profiling of growth perturbations of the human malaria parasite Plasmodium falciparum. (2010 Jan, Nat Biotechnol) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular merozoite and late schizont

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex and not parasite plasma membrane during early schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_22409

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_133890 glideosome associated protein with multiple membrane spans 1, putative
  • PY04760 hypothetical protein
  • PVX_116685 hypothetical protein, conserved
  • PCHAS_134350 glideosome associated protein with multiple membrane spans 1, putative
  • PKH_122940 hypothetical protein, conserved in Apicomplexan species
  • TGME49_002510 hypothetical protein
  • NCLIV_022420 hypothetical protein
  • NCLIV_022430 hypothetical protein
  • cgd6_2210 membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene
  • Chro.60259 multi-pass transmembrane protein
  • CMU_007660 hypothetical protein, conserved
  • TA17740 hypothetical protein, conserved
  • BBOV_III001540 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>MAL13P1.130 glideosome associated protein with multiple membrane spans 1
MFFTYVVRPGEAPEGRGPQFEPFWDFFMNFNLRVGFLIQFISYILLVGAITIIGKNPLGMLNFLRALPGSVGTAPMPLVL
FSIGGFLMGTLLIMSFLQLTEDDSSIKQSRGYRAGTKFLLQATSMGTVSWSLSLICLMASSYYFDDPWMEEKIGAGSSWI
LYFSSRLIDAFCLFLYGSGCFFLEVYHSEGAGEAWGWLCGMCFIATSFVEVLALTLFNTPLFSSLDWFYCLFLGLSLFFS
VIWGLLFEPISHRYDVKLTQSAMRNEYYKSRNAMAYYGPAVVTANGELDIEASTENIAACKQC

Gene-Specific Links for MAL13P1.130

General Sub-Cellular Localisation Links