ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

MAL13P1.122 (SET2)

SET domain protein, putative, a gene from Plasmodium falciparum

Compiled localisation
far nuclear periphery during schizont and trophozoite

Who localised this protein by microscopy?

Volz, J., Carvalho, T. G., Ralph, S. A., Gilson, P., Thompson, J., Tonkin, C. J., Langer, C., Crabb, B. S., Cowman, A. F.
Potential epigenetic regulatory proteins localise to distinct nuclear sub-compartments in Plasmodium falciparum. (2010 Jan, Int J Parasitol) PubMed / full text
   more detail about this publication

far nuclear periphery during schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12137

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>MAL13P1.122 SET domain protein, putative
MEYKLFKNKKILNEKVNELTKKNRQRNTLDHINCIEIDDDDDDDNDNNEEPKEMNINKTNNNNNDILMKSCNDIRRNTTF
YRHNVINEEQKNFEYLLSRKKKNVDSIDNVNFYDFMKNDFFNIFNNNIISEHKKTNQIVNQINNNVDTSKNVVYNINYDE
HKGEVVNLSFDKKGKETYPQVDIELYNKKMNPRYQNINEQNTCQTSDDNTTYRNVYSDNCALNSSYTNFLRNKSLKYKKC
YKQNRQDESTGAEFDYNLDESVYYDDCNNKLYKRSFLKNNKNIIEKGREEHKQDIYNNISDICKSYIKNFDYLNKRIFHN
KSKIWKLSNKKVTIHGDPKKRIERNKQEIEDHRREQDGENDQEEDNYDDYDDEDDDDDNCHIYDNYDDYLENDDYDNHNY
FYHKNHDVNKIRKIQNKNCSTDFINYTSINNRNMECPNKNADNLKNMDSFLLYMKERKIKKKKNINDHMENQLSDTLNNS
NNYNKDVYDSYYDDMNFCYDKDYNMILKKGVNSNRTKSLDRYPNNISHNYVNNISSEIIKYCKDNNITLKSDIKNIINHF
NKKYANSSLTNSKISMYENGYPQRSVDRIYDSSTNDPKSDMNGSNNNNSSSNNNNNITHITNDCDNTQTNKNKHYVNSIV
NSIVNIFQKRKNVNEKKENINEQNCISFNTNLRNNKLNNNDDLCSNSYVNNINRNKQITNNENKKDNMLMLKGTYHGDSL
NESINIEHNLKNNNSMSDVNFVLNNNDNDKKQNSYDISEVSINCYYDDVIKCYMDYTMHGMEDETNFYLCEFCEQNIFDM
NNMIKKDKAKECMYRCNISCGRTFHKACVCYIKNNDNYICFFCLYDINFCTLCKEVLTNDSLLPCYYPLCSVSMHTKCVE
KLLLFNSHCLKQYESIILPRDINIEQQKNTQKSASDGIIEQPLNIKKKIKRRHIYRKRRRRGPRKSQITTSNKKINKSEL
AGGSIINGVDMEQENDQGGNNNNNDDNNDDNNDNNDDNNDNNDDNNDNNDNNDDNNNDNNNNNNNDNNDNNNNNNNNNNN
NDNDNNNNNNCDENFKNHLLKKDLLRDEPHHNNYDKILECNTEIKMENNVNMSEEPIYNKLFNGKEETLNNENDEKIIVL
KKFICPLHICYVCKEFDINNTESSKKELKNNLFRCIKCYKSVHRKCMNQLKNNDNNDNDNNNNNINIYIISHKHRIICCA
NHMDDYKKEHMEYLKYIKEVKDICKLDEPIHNNNNNNNILSEKGFYGDENNLSISKFHNNSSYEPIKNKETCIKGKDSNY
LSHDNKGITDMNNTNKMNVLNLKSCMVNDMNTSERKKKKSCESRGSNITNKKVVFDLTDELNEKEKSPPLDNVQNKIIYG
DNEIEKNVNICQKEDGGLNLGSMNILSIGKNHMRTNNNNNNDSSCSSNNNIISVENEYILKNKNLNKSNNSLLDHNNKIK
KNSTLNIKECTDSCINVDEFINKNQNEKDISLENIDALCIKRKRNVSHPYNDTLDDTNILKDISNNKSYYVNISKKKRNV
SFNYKEEFMKGDEQFLLKGNNLESNEKNTKNKLCNNDNNNNNNNKGKNTKYNTLDRKNNKNKQINDTINKEPENINHNMQ
NQQLTDNFVEDNMKYKQEIYHIKLSHILSIEKGLLSLQEINIDQMNDECKKHISILCTFRQDFINYVIFLFSKRLHKENQ
IEPVNGVDHKKEGNIYHAERKQEKINHNAKHNEQGSINNAKHNEQGSINNAKHNEQDSINNAKQNEQDSINNAKHNEQDS
INNAKHNEQDSINNAKHNEDDSLNNAKHNEDDSLNNAKQNEEDSLNNAKQNEEDILNNDDHRNQEELHERWKENMVYNFL
ANYDKKEKKYISKKEEDAIIKILSNDIVGIMKKELKISLYDFIMLKKKTISTNENHKDNDESVVYVEDGKHHCNDINKMK
DNVNNDIIPNIKYNNNNYDDVINTKEKESIPDASYMKVTRNQSIMNNDIYNNNIQIIEKERIMNNNKKNYYDEEKKREEY
NGLFSKGKKKSFKNNKMDLKTFFSLTNNGYKVDISILKKYSSFLKFEYISKNIYLNDKNKNLLACKSDDYKCLCQGECNL
YTCYNSLSNIQCSKSRCNLPEKIQDRKCFNRPFRKSFVKDLEIKKTEKTGYGVFCKRDIKNGELICEYVGEVLGKREFEK
RLEVYQEESKKTDMYNWYIIQINKDVYIDSGKKGSISRFINHSCSPNSVSQKWIVRGFYRIGIFALRDIPSGEEITYNYS
YNFLFNNFECLCKSPNCMNYHLLKKGESSGASNIIKETELLNNTIFNPVENFHNLHGKMQDWNIFIEEAHTRLLYEYNKM
NAFNLRLMECYSTWIFYDMNFQKNQFFSLKSKPYNVSAEFWKVLVSAFSDGEKNIINTFNLFLPSLIKIGQLRRIQQYSY
ILHNIIGLEHDMWNLIDKGFADDEVCRKCKSCGNLTMCDKCFQSYHQLCGNMHSKMYKNNELVLCRFCQKYDYKIQWIKE
NHGSKMKTCIEIRSKAFYKLNRDIMTLLEESVKYTQNQSLDSIHAHNTKAFKSKKLKLRKFQYKYVKI

Gene-Specific Links for MAL13P1.122

General Sub-Cellular Localisation Links