ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCU25743 (MSP1)

gi|1163895|gb|U25743.1|PCU25743 Plasmodium cynomolgi merozoite surface protein 1 (MSP1) gene, partial cds, a gene from Plasmodium cynomolgi

Compiled localisation
merozoite surface

Who localised this protein by microscopy?

Longacre, S.
The Plasmodium cynomolgi merozoite surface protein 1 C-terminal sequence and its homologies with other Plasmodium species. (1995 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

merozoite surface
  • "The Plasmodium cynomolgi merozoite surface protein 1 C-terminal sequence and its homologies with other Plasmodium species."
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: PCU25743 taken directly from publication
  • Localisation record: merozoite surface
  • Comment: reference to older paper
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This species does not currently exist in the OrthoMCL database.

Amino Acid Sequence

>PCU25743 gi|1163895|gb|U25743.1|PCU25743 Plasmodium cynomolgi merozoite surface protein 1 (MSP1) gene, partial cds
DQVTTGEAESEAPEIIVPQGINEYDVVYIKPLAGMYKTIKKPLENHVNALNTNIIDMLDSRLKKRNYFLDVLNSDLNPYS
IPHSGEYIIKDPYKLLDLEKKKLLGSYKYIGASVDKDMVTANDGLAYYQKMGDLYKKHLDEVNAQIKEVEANINKHDEEI
KKIGSEASKANDKNQLNAKKEELQKYLPFLSSIQKEYSTLVNKVHSYTDTLKKIINNCQIEKKETETIVNKLEDYSKMDE
ELDVYKQSKKEDDVKSSGLLEKLMNSKLINQEESKKALSELLNVQTQMLNMSSEHRCIDTNVPENAACYRYLDGTEEWRC
LLYFKEDAGKCVPAPNMTCKDKNGGCAPEAECKMNDKNEIVCKCTKEGSEPLFEGVFCS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCU25743

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins