ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_143060 ()

iron-sulfur subunit of succinate dehydrogenase, putative, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10334

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0630w iron-sulfur subunit of succinate dehydrogenase
  • PBANKA_142880 iron-sulfur subunit of succinate dehydrogenase, putative
  • PY04921 succinate dehydrogenase iron-sulfur subunit
  • PVX_123345 iron-sulfur subunit of succinate dehydrogenase, putative
  • PCHAS_143060 iron-sulfur subunit of succinate dehydrogenase, putative
  • PKH_143010 iron-sulfur subunit of succinate dehydrogenase, putative
  • TGME49_015280 iron-sulfur subunit of succinate dehydrogenase, putative
  • NCLIV_052230 Succinate dehydrogenase iron-sulfur subunit, related
  • CMU_014010 succinate dehydrogenase [ubiquinone] iron-sulfur subunit, putative
  • TP01_0210 succinate dehydrogenase iron-sulfur subunit, putative
  • TA19430 succinate dehydrogenase [ubiquinone] iron-sulfur protein, putative
  • BBOV_IV005280 succinate dehydrogenase iron-sulfur subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_143060 iron-sulfur subunit of succinate dehydrogenase, putative
MGKPNELRYIMGLLNKRVWNNINNKKVKFFSSDNNSTASNAININRYVNDKSDQAQKNELKRFSIFRYDSQNNKRPRMQT
FEVDIDNCGPMVLDVLIKIKDEIDSTLSFRRSCREGICGSCAMNINGKNGLACLTEVNKNKNEITEIHPLPNLYIMKDLV
ADLTNFYNQYKSIDPWLKRKTKKEKGQKEFYQSIEDRKKLDGLYECIMCASCSTSCPSYWWNPEYYLGPATLMQAYRWIV
DTRDEYTQERLMDMNDTMKLYRCHGIMNCSVCCPKGLDPAKAIKHMKELVQENFSKDNIKAHANYIKDKMENEEKSIDKE
K

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_143060

General Sub-Cellular Localisation Links