ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_133740 ()

biotin carboxylase subunit of acetyl CoA carboxylase, putative, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11078

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF14_0664 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PBANKA_133280 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PY01695 acetyl-CoA carboxylase 1 precursor-related
  • PVX_116985 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PCHAS_133740 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • PKH_123560 biotin carboxylase subunit of acetyl CoA carboxylase, putative
  • NCLIV_004860 hypothetical protein
  • NCLIV_061720 hypothetical protein
  • cgd8_3680 acetyl-CoA carboxylase like biotin dependent carboxylase involved in fatty acid biosynthesis
  • Chro.80425 acetyl-CoA carboxylase 2
  • CMU_005960 acetyl-coA carboxylase protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_133740 biotin carboxylase subunit of acetyl CoA carboxylase, putative
MISIFLSILLFVLIFENPTKSIKIRNTYYMHMYNNVNANNFAEKETRDQYPNRKGPNNVLSENYRNKFMPLFVSKGTNAL
NSILKNKTVRYLYNNSERNTQKNSKYNSKSSAFLYTLHKYSNALSSSFKSKSFNGDDFDIEKLRNNNDEDNDSISNASNR
CHSYDIDKTYSYDNIGHNLDEDPEERSFSFTSNRNDAQSDIKNDSNCNYITRDDLKKKNNNVNNGEKKVLENLIDNFSNL
NVSNNITDDANLNQPQYSKEFDSYIKSQNDQLLHYYSDSILEHLYSFKKFNTQNKKKKKNLNKLFYSFKPLENIRTLKKR
TINVHPTQNNVEKETPALYREKNGGSISNINKRQTQFGNKRIYMKKSDTCEINENEHVDDTEFLTYEETNNIKKKAYRDY
INYINERRYPYINYLKTKNEKIIKKLLIANNGMAALKCILSLKEWLFKTFNDENLIQIIVLATEDDIRSNSKYISLSDKV
IKVPPGKNSYNYANVSLIVDIAKKENVDAVWPGWGHCSENPLLSSMLEKENIIFIGPTDNVMEALGDKISANILAQSVNV
PVVKWSGDNLKIDDFENNSINQDIYNKSTIHSLEECISECKRIGYPVMIKASQGGGGKGIRKVENENEIKKYYEQVQNEL
PNSPIFLMKVCSNVRHIEIQVVGDMYGNVCSLSGRDCTTQRRFQKIFEEGPPSIVPPHIFREMEKASIRLTKMIKYRGAG
TIEYLYDQINNKYYFLELNTRLQVEHPVSEGITDTNIVAIQLQVAMGIPLQNIDDIKKLYKIEEKTKKNASLSSVSSSSD
NLKLSISEKDNNSVVKNNLSEKLGMFDFYNNMPHTKNHVIAARITAENSNDSFKPTSGLVKNVNFQNSKDVWGYFSINNG
FVHEFSDSQIGHIFAKGETREMARKNLILALRKLNIDGEIKTVTKYLAKILESKAFIDNNITTNWLDVVIERKKNIYYNT
FHIIILCAAIFKLLIYFMKEMENMEDSLNREDIAIKSENSINDISLKGKMKRAYIFDIIFQNVKYMFKGYNTGEDLYKLN
INDQEIEILAKYDKENNKIFASFHNQTYIYTCIEDSLGTHMNLGKDNVFIPVITNPYHLISNTNGKIVKYLIKDGEKINK
FDDYIEVEAMKMIMTFKSTETGILKHKMSEGAMIKIGDLLGVIEKEKDNHNSPNDDNNNKIIDFVGHLNLSNKNAYELDG
TFFPDLAEESHNNEMFCDNIDEEKLENIRKFENSKNDKIDSKQHINSHSQDDTTNESVSVQDIKTGGVKTNETQYFTEDE
HIHKNQVNRRNKLFLKKKNGENNKNNMFRLFSQKNDNNNKIIDSHMESEPTDGTSSYDKINKKTTNNESLMPPKKESEDA
TNMPGITKETSIGSKNYLNEKFNSVKKYLTNLNLSITNTINKMSSSSNEELINDNSENNLSTTNTMHNDSVGNSGSNDSL
VSQRTNNISEERIDNSDNFISYDSYKNQSYKDKKVSTEIGFPVNSEVKNLNKAKIISDTEMSRSIDDNSQSSRNRADTSC
NEDAELNFDNRKDKGNEFFLELSNTKRIEYLLKGYEQDYEKCFENFLKDKNNFDTNLNYILDKFIEYNHLFSKKEIISEV
EIYSILYNSISDKKKQCEVIHAYTYNYLSIKFLEKILNNLINSKKMDLSLQILNKIKILKEFKGKIFGSIILLSRYIIYL
YEQIEKIHYLESSFQYNKNMEDMKKQSLQNYIRLLTKSKNMDNYKIDKILNNTNCEEKIKFFLKSPLDIHNFLPFLFKTE
NYNYQEMLNTYLSNLYKYSTIKAKSHSSNCLIFSVNNHEYNNVMLNLNQDITIEQFKSMMDDILYETKSDMINTLHIINK
NETFFNSLQNYLDIAAKKVNTLYIYNYFGNKYSEIHKIDMNTYKERQKVQDNHETNKNDSTINSKIYLLPFEEEILTSED
IAANFELKNVGQEIFNKTKISLGIYKQNNKYTSLFAQRIIDINDLQKQADSGNAKMHDEHKQIEMTPNGKNNILLSKNIE
KGQINNQIYDLFMSELKESIEDISTYRLNPSIQDIKITSNIIYHIVLPNNSNIEDQINGIKQIYKNFLNKYNELFIDNYV
NNVYIKVYAEIKDKTNNETKLELNQLLKLHVLFDNEKEVIEQVDKINPVLIDTLYLKRKRARDVDTTYAYDFVKLINIAL
NRINNTLNDNFNYINSVKEFKLDYSMEKSEETNDAISAGKKEKSQPNKNDKQSKWLFENFDNLSNDEIRIKKSLYLSNSL
EIGQNKLSVIGLLMNVKTDEYKEGRDIVFIINDITTNGGAFSVLEDELFYGVSCYAREKKIPRICISCNSGAKIGLYNHL
MDKIKVCWNDENKKELGYKYLYITEEIKEQIPKKDIIYLREIYENGEKRYIIDAIVGNLNNHIGVENLRGSGLIAGETSK
AYDEIFTLSYVTGRSVGIGAYLVRLGKRTIQKKGSSLLLTGFNALNKILGEKVYISNEQLGGVNIMMKNGISQLEAENDQ
DGVDKIFKWLSYVPKTSDNYFDVLREPTKLTHNKFQENSKPGFSKSKNINNSIDSDQESDNYPKGYTNDEDIQKYAQKNS
LHSSSDSTTFEPESVKESDTSLMHINEKNYDEESANEISDVIPDNWNQINDIDMDNVNEADIIELLKGSDKKQGFLDKNS
YFEYMNEWGKGIITGRGKLGSIPIGFIAVNKNLVTQTVPCDPALKTKAIKTTNAPCVFVPDNSYKTAQSIEDFNKENLPL
FVFANWRGFSGGTMDMFNSILKFGSMIVNQLVNYKHPVFVYIPILGELRGGSWVVVDETLNSQIIEMYADTNSKGGILEP
PGLVEVKFKFSEIKKLMNNSDPYIIELNQKLATLQNEEEILSVKKEIEKKEKEMLPFYLQVCHKYADLHDVSSCMKEKGV
IRKIVPWEKSRSFFYYRLLRRLILHTLNKKFGDSYAKSDEIKNIIDDLKNSESDDQVVCKRVLTGNVLKNINKINDEILH
KKTLDGIFKEFQNLSKTQKMELYKKISSYEF

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_133740

General Sub-Cellular Localisation Links