ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_131180 ()

fructose-bisphosphate aldolase, putative, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10632

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_130860 fructose-bisphosphate aldolase 2
  • PY03709 Fructose-bisphosphate aldolase class-I
  • PVX_118255 fructose 1,6-bisphosphate aldolase, putative
  • PCHAS_131180 fructose-bisphosphate aldolase, putative
  • PKH_126150 fructose-bisphosphate aldolase, putative
  • TGME49_036050 fructose-bisphosphate aldolase, putative
  • NCLIV_050380 Fructose-bisphosphate aldolase (EC 4.1.2.13), related
  • cgd1_3020 fructose-1,6-bisphosphate aldolase
  • Chro.10335 fructose-1,6-bisphosphate aldolase
  • CMU_029810 fructose-1,6-bisphosphate aldolase, putative
  • TP01_0101 fructose-bisphosphate aldolase, putative
  • TA20060 fructose-bisphosphate aldolase 2, putative
  • BBOV_IV000790 fructose-1,6-bisphosphate aldolase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_131180 fructose-bisphosphate aldolase, putative
MVACVEYKNAPMKLPKEVAHELAETAKKLVAPGKGILAADESTQTIKKRFDNIKIENTVENRANYRDLLFGTKGLGKFIS
GAILFEETLFQKNEAGVPLVNLLHDEDIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYYKAGARFAKWRAVLVID
PVKGKPTDLSIHEVSWGLARYAAICQQNKLVPIVEPEILADGGHTIEVCATVTQKVLASVFKALHDNGVLLEGALLKPNM
VTAGYDCTEKTKTDDIGFFTVRTLRRTVPPALPGVVFLSGGQSEEDASVNLNSINVLGPHPWALTFSYGRALQASVLSTW
QGKKENVAKAREVLLQRAEANSLATYGKYKGGAGGSTAGASLYEKKYVY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_131180

General Sub-Cellular Localisation Links