ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_101300 ()

methyltransferase, putative, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10615

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0309 protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase, putative
  • PBANKA_101220 methyltransferase, putative
  • PY05016 protein-l-isoaspartateo-methyltransferase-related
  • PVX_084910 protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase, putative
  • PCHAS_101300 methyltransferase, putative
  • PKH_131660 protein-L-isoaspartate O-methyltransferase beta-aspartate methyltransferase, putative
  • TGME49_115130 protein-L-isoaspartate O-methyltransferase, putative
  • NCLIV_057890 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_101300 methyltransferase, putative
MLYSVLKLLIYKYILNINFWILQKLPYETRISNLIFCKHTNKANQYIFINPVKYNIQKKVTKGIRPSNIMYAIVENNHRD
LINNLKRRGIIDDDDVYDTMLQVDRGRYIKENPYIDTPIYISHGVTISSPHMHALSLKRLMNVLKPGSRAIDVGYLTVCM
AIRVNVLENKNSFVIGIERVKDLVDFSIENIKRDKPELLNIENFKIIHKNIYQVSEEEQKELGLFDAIHVGASASELPDV
LINLLAENGKLIIPLEDGHTQVLYEVTKKNGKIIKDRLFEVCFVTLKKN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_101300

General Sub-Cellular Localisation Links