ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_100150 (EMA1)

erythrocyte membrane antigen 1, a gene from Plasmodium chabaudi

Compiled localisation
cytoplasmic side of host cell membrane during intraerythrocytic

Who localised this protein by microscopy?

Deleersnijder, W., Prasomsitti, P., Tungpradubkul, S., Hendrix, D., Hamers-Casterman, C., Hamers, R.
Structure of a Plasmodium chabaudi acidic phosphoprotein that is associated with the host erythrocyte membrane. (1992 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasmic side of host cell membrane during intraerythrocytic
  • "The antigen appears to reside on the cytoplasmic face of the erythrocytic membrane."
  • Microscopy type:
  • Microscopy method:
  • Strain:
  • Gene model mapping comments: blast from M95789, annotation matches
  • Localisation record: cytoplasmic side of host erythrocyte membrane during intraerythrocytic
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21709

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PCHAS_100150 erythrocyte membrane antigen 1
MKAISLGLISSIIFSIVLAKNSSGSGSSTGCFGCFRKKPKKKILATEVAKPVKAPETADFDPKLPNLKFIEEFEPITIEG
CKSRLHELDEPFVSETDGMIIDKVTGFSRRENDSVLSGWYIRPYEEGYENMIKVNFIPLREYYKRMENRPPKQYDGPPPV
PDMPQGYVPPKKEEIPVEQYVIQLSEEDPYLLQEEDALSLMEYDAETLNEGDAETLNEGDAETLNEYDAGTLNEEDAGTT
NEAGEGTTNEEGEGAANEYDAETLNEYDADTLNEYDAGTLNEYDAGTLNEEEGSTTNEAGEGTSNEAGEGTANDDEELDE
EVASIFDDDEHADDLSLLDYDENSNENQENVKKGNENEGEQKGNENEGEQKGKKKKGKRKVKKEGEEQTDDDDEEEEEEG
EEEEEEGEGEEEGEESESGSDNGSFLGDGEDDE

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_100150

General Sub-Cellular Localisation Links