ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_093520 (PDI)

protein disulfide isomerase, a gene from Plasmodium chabaudi

Compiled localisation
cytoplasm and nucleus during blood stages

Who localised this protein by microscopy?

Novo, C., Martins, T. M., Prata, S., Lopes, A., Armada, A.
Gene sequencing, modelling and immunolocalization of the protein disulfide isomerase from Plasmodium chabaudi. (2009 Nov 1, Int J Biol Macromol) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during blood stages
  • "Results obtained for the intracellular localization of PcPDI in P. chabaudi-iRBC by IFA (Fig 5) showed that the labeling appeared spotted around the nucleus as well in the parasite cytoplasm. The PDI was also recognized by the mAbs in all the erythrocytic stages analyzed, Fig 5: late trophozoite h); schizont with merozoites e) and young schizont b). PcPDI localization seems restricted to the parasite cells suggesting that the selected mAbs give a fluorescence pattern similar to that described in P. falciparum [43]. "
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: AS
  • Gene model mapping comments: blast from AY769864, annotation matches
  • Localisation record: cytoplasm and nuclear during blood stages
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10306

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_093520 protein disulfide isomerase
MNSKYFSFLLFLIPFLFQNCVRSHEDLFNEHVTSIHDGELTNFITKNDIVLVMFYAPWCGHCKRLIPEYNDAAIMLAEKK
SEIKLASVDATIERGLSQEYGITGYPTMILFNKKNRINYGGGRTAQTIVDWILQMTGPVSTEITGNIEDVLKEKNINVAF
YIEYTSEDHELFKKFNEVGDKNREIAKYFMKKNDKHNKIYCYRKDEKTVEYDEKTPLSDFITIESFPLFGEINTENYRFY
AESPKELVWVCATIEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPGLAYQSSEGRYVLTNPKQSLK
NHKDIITFFKDVEAGKIEKSLKSEPIPEEDKDAPVKVVVGNSFIDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEELGRKL
KKYDHIIVAKMDGTLNETALKEFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHSTKTPITIDGVSQSDDGASE
EL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_093520

General Sub-Cellular Localisation Links