ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_090470 ()

MIF4G domain protein, putative, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PCHAS_090470 MIF4G domain protein, putative
MLNTLLNITTSYKSSECKEKNILNNKVCFKDKYNKEEEDNRKKSANNFNNNITDNNNEKNNNSSSTIPNSIKSNLVNSAN
YSNMQNGHSEKSSSSTKCMAYNLQAKEVNNCDDNTNKNEELNKFEKKENDTTMNMTLSGKNDAVDFEKSSNNNSNNDNAI
INSNRNNNIGDLKNSEHVNNSQDNHNNLIKNHELVNNSNFTIQGTSSTCNVNESFAVATGNNTFSSLHKEGNNNNCSSNS
EVISEVDYSQGTVKNASSVANSSHILPKPSNDYNKIENSDEKCDNANNNSHNNQESKINQFSESQKNSESTVNDKINNCT
SSNNNGTENNDNKNSHGNNSGSHNNNSNNNNKGGSGNRSGNNSNTGNSNGGGSGTDPDGNDNKDDNNEKDKDKNNNNNIN
DNNSNNNDKIKKKENNNKNGDPNAKKTNKNVNSNDNNETKKSNTKSLLSNTNSSSTISGSSLNADAPEFVPSTKSGQGNL
QFNNLMWGNYYHDIPNNSFANMQNVNLMNMNGLGNNNNIMIQNPLIDNMGNINNDATGNNLLGIQNSSNNNNAGGIAGSN
SVNKNNTSGNANTPLGGQFNGVDGNEKFTDKNSNTTPISGNNSKVNNNNIHSMNTEDGNKSLGGTGPIDSTYLNHNMLEG
GKNIRPNNFMNSSENANGFDNADMHNTNNNNSNNNNAHQNFPGNNSMMHHHPHHHNFYLNPPYLINNHPNGLSGHQTIFT
SMPYGGGGVAGANNGDIHHELPFPQPPVYNHFGNNSMNVQKNANLNMNPYNFISCGIPGAGPLGTGGPINMASHHHMDPH
FLNSTDNVPMKLPYNHMGQTNRRNSMFSHFGNNVNLHGPNNMNENNYDINSNNNNMNPLLSANMGGAGYVFNSSYNSMQP
GVMRLNTDGNSSTTTNNTSSNANNNATTNSANNNSAASGSNNNGSLNTSGTVMGLNSPIINPGVNVPIPHHHIDNINNPM
HMNGMHMNHGLLLNNANINNMHNMGNHVPMGNVGTMGAGIVGLVGVGGMGGMNATGNMTKQQKRQSVYNDRNAGMNNNSN
NNAENVGANNNTTGSGANNKQYNNNYKENKNAMKNNMGNEALNNYNYGMKHENNKKNNSRYNMMNNTGDNFNTNYNYNGS
NTMKNNPANTKGSYNNKGGKEESNNLAGGNNFYNRNGTNTSTTGGGSITTTTGSTTNNANTSNDTNKESGGSGDAPKDAP
SDLNESNNTKSSNNKDNFQYGNYKGKNNYYLNSSNDKNSKGHSNTASNQNSATTSNNKEDYKSGRNYGSNKIGDDKSGGS
VSKKDAGKDNTNSNNNSGRYGKQGDNWAKKGYGANSSNTSNNVNSRTNNSTTKHGSYSNSKYNTGSDRRGSNARYDESSK
TEKLGYKTNDKKGKPEEDKHTKENRSNSNSNAGLNNNQVNETGNKNSNTNPTNEENNKAGYNNLKNVKNGDKKNMEFSSW
VKIAKMNPNTKKKNEKVNASSSQVDNTNAGGSAKNGNTDETNHNYSNSRNYNKGAGYGKGSHGEASQVNEENETSLGSTN
KESKKNAEMKEDTKKESHLLNGTSSTNQRYDSNSKGMKKSGGVDDKLNGNIKGKSIGNYSGNSKNYMNEENRNKDSNRSK
GIDNKHKTSNSNNMNANNSSNKKIDYNDKKNISSNLNANNNSYSHRQREKLKIKNVEIKQIGEKIVPNVSSSSVRNSSTG
HNENEDKKDAEKNKNNNTHTSDNVNQKKETDEVTKDEIKQAVNLNEKNYTDEENADNKDLTKKNEINNASSNVNKNKEIG
KDESMNGQTNNLDDNAKGKKSSIFSQSKNNYKYGAEGEYNPNTNTSNENNNKTGSSNNKGSLWNGKISFAEMAKRRPKKD
SKDISKEWAGNNRSGQTDKKGSSLNKNGKGLRRTDDGYTKQEQNGNIAYDEKSEMNDEELTKEDDKDEIKREDEIENVEK
EEKIDNNKNVDDIETSNELANEGKEIVSTSNKDAENKATEELGGEETKQNKDNTADDKIAMNANEDGKDGISAKTNDEEK
DAENKLDNKENEKTEELNSEKSKKNDDESENKNAVSDEKNDTKVSDMDNDKLNNENVLDPKQKEKQKKIERWQAEKRFTK
IDLLEIYLGHNWSLRGENFNFVLSQDNTTDTHYKGNNYMHNNMNSNDDNNNNSGMNNMYMNDTKNVNTYNNKRYSNSGYN
HGNNMNNAQMNQYNMHNSGNNMGNNANNMGGNNNYDKNMQGNQNSNSGKGGDDGWRHAFSKNMQNNMHMNSGNNNMNYMD
GNHNDPNNMNANNNSGNQGGKGNNFEWRKGDGDKLKGFFDSTRAVESPDAWRNNNAGQQNGSGNNSKPTMSENSWLVKQS
QLKADKYTCLMRKLRGILNKLTFEKFDLLYEQIILVDISKLEEIIGLMKLVFEKAVTQHHFVQMYVQLCKKLNIHFHSMK
LEDGSVVQFKKILINQCQDSFENNLKPIEFPSHLNEDEKFEFEQMHKNKVRGNMLFVGELVKSGIISIPIVFVCINQLLE
KRDSYISQKNDTNEGNLHLEALCMFLNTVGEILDTHEKSNQEEVKNLYNKLNEIVNDESILFRVRCLIKDVIDNRNEKWN
KKFAHKLEGPTTLSVLHDKILKETIDQNNRIFSGNNSGNYHDNKMNSSLNNMRNNLLRNSNYGMNNNSGSGGMGNNNMPY
GMNNQMNMRGMGNTGMKNMDPNKNMKKMSLNMMKNKNASSKMMNDDMKFGQNAGTHFGEGTGAFGTDNNAGGNYYDNNSK
NNMPYKNQAFMGNDNNNSGAGGSSSNAPNNNANSNNGIFGNISSMFANKETKNEGNFFSRVFNLKKNQNNNAASGATQDP
SFRGGADANTNKDNENNINGAENQTNKDTNKANENEQNDYSYVEDYLPKINELMELSTNVNEWDELTKKLEELNIPSKYN
EKLQNTILKLTLKKYACNKYLERSESYFNWLVATVLANKIDLVSFKSCWKSFFLEADENSYEYTKEDYPLLPFLAKNFIK
AVELHDTNHILYDVDALNEIKNVV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_090470

General Sub-Cellular Localisation Links