ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_072600 ()

conserved Plasmodium protein, unknown function, a gene from Plasmodium chabaudi

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_24403

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_071690 conserved Plasmodium protein, unknown function
  • PY02199 hypothetical protein
  • PVX_089700 hypothetical protein, conserved
  • PCHAS_072600 conserved Plasmodium protein, unknown function
  • PKH_051860 hypothetical protein, conserved in Apicomplexan species
  • TGME49_061440 armadillo/beta-catenin-like repeat-containing protein
  • NCLIV_026070 armadillo/beta-catenin-like repeat-containing protein, putative
  • cgd2_370 ARM repeats containing protein
  • Chro.20044 hypothetical protein
  • CMU_002240 armadillo/beta-catenin-like repeat family protein
  • TA05340 hypothetical protein, conserved
  • BBOV_I001940 conserved hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PCHAS_072600 conserved Plasmodium protein, unknown function
MGNRCCTGRDLLYKSKLQELGIEGSKTIRKLLSFTNNDIIRFDKAYDENDVQEFVNLCSSTCEIEKLEDRMHPWAADPKT
IGALSATQLAILASKENEPHYKDAIRESNGIPVFINLLKSHELDRVHAAVVALSFLSVDNVKNCICMFENGALPYLITGM
KSNIDGMKAACAQTCRNIFVLDKSYKKEFLKLGGITQLVNLLELPPTDDNLPLYTQLEAIYHLEDFILNDGDEVPQFLEA
VKKSDAIKNLKALQQCPEQDLAEASNVLLLRLTD

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_072600

General Sub-Cellular Localisation Links