ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PCHAS_000190 (Ag3008, Pc24)

early transcribed membrane protein (ETRAMP), a gene from Plasmodium chabaudi

Compiled localisation
parasitophorous vacuole membrane during maturing parasites
dense granule during merozoite

Who localised this protein by microscopy?

Favaloro, J. M., Culvenor, J. G., Anders, R. F., Kemp, D. J.
A Plasmodium chabaudi antigen located in the parasitophorous vacuole membrane. (1993 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during maturing parasites, dense granule during merozoite
  • "It is located in the parasitophorous vacuole membrane of maturing parasites and in the dense granules of merozoites."
  • Microscopy type:
  • Microscopy method: antibody
  • Strain: adami
  • Gene model mapping comments: blast from L19784, annotation matches
  • Localisation record: PVM during maturing parasites, dense granules during merozoite
  • Comment: no fulltext available online
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_60733

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PCHAS_000190 early transcribed membrane protein (ETRAMP)
MKVPKVSAIFLVFLLSVCFLSSPSLCDANAGNKIPNASNPAVNGNSAENAQGPAGSKTNNGPASEKKDSKDIAKIDDKIT
AKKSAKPVIIGTISTIAALAIASALGYGMYTKNKAKAKAKKEGEEADATDDEGTDTEESSDSAKEVEDLVSEIADELGDD
VDDDAQTPEKTK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PCHAS_000190

General Sub-Cellular Localisation Links