ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_145950 (MTIP)

myosin A tail domain interacting protein MTIP, putative, a gene from Plasmodium berghei

Compiled localisation
inner membrane complex during early hepatic and extracellular sporozoite
not parasite plasma membrane during early hepatic
during not early hepatic

Who localised this protein by microscopy?

Bergman, L. W., Kaiser, K., Fujioka, H., Coppens, I., Daly, T. M., Fox, S., Matuschewski, K., Nussenzweig, V., Kappe, S. H.
Myosin A tail domain interacting protein (MTIP) localizes to the inner membrane complex of Plasmodium sporozoites. (2003 Jan 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex and not parasite plasma membrane during early hepatic
  • "Taken together, the IEM localization, the TX-100 solubility characteristics and the pattern of loss in hepatic stages strongly support an association of MTIP with the sporozoite IMC and not the plasma membrane."
  • Microscopy type: Light, EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from orthology to PY00409
  • Localisation record: IMC and not PM during early hepatic stages
  • Comment: Disappears as IMC breaks down during hepatic stages
  • Comment: strain information not found in paper
  • Other genes localised in this publication: myosin A tail domain interacting protein MTIP, myosin A

Kaiser, K., Camargo, N., Kappe, S. H.
Transformation of sporozoites into early exoerythrocytic malaria parasites does not require host cells. (2003 Apr 21, J Exp Med) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular sporozoite, during not early hepatic
  • "(A) An extracellular EEF that shows complete circumferential MTIP staining indicating little IMC loss. The trophozoite has a single elongate nucleus. (B) An extracellular EEF showing partial IMC loss. Two closely associated nuclei are visible showing that this parasite has undergone a first round of nuclear division. (C) An extracellular EEF showing further IMC loss to 30% of its original size. Two separated nuclei are visible. (D) An EEF developing within a HepG2 cell 24 h after infection. Loss of the IMC occurs similar to the loss observed in host cell-free development."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: NK65
  • Gene model mapping comments: inferred from another publication
  • Localisation record: IMC during extracellular sporozoite, not during early hepatic
  • Other genes localised in this publication: heat shock protein, putative, circumsporozoite (CS) protein, thrombospondin-related anonymous protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23366

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_145950 myosin A tail domain interacting protein MTIP, putative
MEQQCHMCYFELPDAKTTIGPYDNELNYFMWGPGFEWKPEPVVKQISGEDTYDETEESEESEHGFDELDEKVNKDDRKIY
FDEKSSSGKISIENASYNARRLGLAPSSKDEEKIRDLYGDNLTYDQYLEYLSMTIHDKDNAEQLVKMFAYFDTNTTGFLT
KNQMKNILVTWGDALTEDEAMNALNAFSNDDKIDYKLFCEDILQ

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_145950

General Sub-Cellular Localisation Links