ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_145930 (Actin)

actin, putative, a gene from Plasmodium berghei

Compiled localisation
apical during gametocyte and mature ookinete and zygote
apical most tip during ookinete

Who localised this protein by microscopy?

Siden-Kiamos, I., Schuler, H., Liakopoulos, D., Louis, C.
Arp1, an actin-related protein, in Plasmodium berghei. (2010 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical most tip during ookinete
  • "The major actin is localized at the apical tip, overlapping MyoA, as we have shown previously [11]"
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical most tip during ookinete
  • Other genes localised in this publication: actin-related protein, circumsporozoite- and TRAP-related protein, myosin A

Siden-Kiamos, I., Pinder, J. C., Louis, C.
Involvement of actin and myosins in Plasmodium berghei ookinete motility. (2006 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during gametocyte and mature ookinete and zygote
  • "Western immunoblots revealed that PbMyoA is only present in fully mature ookinetes, whilst the other two proteins are additionally expressed in gametocytes and zygotes. Immunofluorescence experiments reveal that MyoA and actin co-localize in the apical tip of the parasite whereas MyoB displays a punctate pattern of expression around the entire cell periphery"
  • Microscopy type: Light
  • Microscopy method: IFA from monoclonal antibody
  • Strain:
  • Gene model mapping comments: Blast from epitope DEEMKTSEQSSDI, annotation matches
  • Localisation record: apical tip during mature ookinete and gametocyte and zygote
  • Other genes localised in this publication: myosin A, myosin pfm-b, putative

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_145930 actin, putative
MGDEEVQALVIDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDEAQTKRGILTLKYPIEHGIVTNW
DDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGV
SHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKS
YELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITT
LAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_145930

General Sub-Cellular Localisation Links