ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_143230 (CelTOS)

cell traversal protein for ookinetes and sporozoites, a gene from Plasmodium berghei

Compiled localisation
microneme during gametocyte and salivary gland sporozoite
gliding trail during salivary gland sporozoite

Who localised this protein by microscopy?

Kariu, T., Ishino, T., Yano, K., Chinzei, Y., Yuda, M.
CelTOS, a novel malarial protein that mediates transmission to mosquito and vertebrate hosts. (2006 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during gametocyte and salivary gland sporozoite, gliding trail during salivary gland sporozoite
  • "We report here that malarial invasion into these hosts is mediated by a protein, designated cell-traversal protein for ookinetes and sporozoites (CelTOS), which is localized to micronemes. CelTOS is deposited as a trail during sporozoite gliding. Salivary gland sporozoites were allowed to glide in chamber slides at 37C for 1 h and fixed with paraformaldehyde, followed (Triton) or not followed (Triton) by permeabilization."
  • Microscopy type: Electron
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: P. falciparum ID PFL0800c taken from paper. Took the first orthomcl orthologue in P. berghei. The other is PB301106.00.0
  • Localisation record: microneme during gametocyte and salivary gland sporozoites, trail during salivary gland sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_143230 cell traversal protein for ookinetes and sporozoites
MNKLTKLSVISSVFVFFCFFNVLCLRGKNGSEMSSFLEGGVESSNRIKKSLASFISESSSLDDIGNGLAETITNEIFSAF
QQDSSSFLQTKFDIKKHIKENAKKVLIEAIRLGLEPVEKIVAQSIQPPKVNRHTYSLVSPVVKALFNKIEEAVHKPVSDN
IWDYAGGDDEYEETEEDNFDNDFFN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_143230

General Sub-Cellular Localisation Links