ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_143220 (mdv-1, MDV-1, PEG3)

male development gene 1, a gene from Plasmodium berghei

Compiled localisation
during gametocyte and macrogametocyte and microgametocyte and not ring and not schizont and not trophozoite
peripheral during macrogametocyte and microgametocyte
extracellular apical pole of ookinete protrusion during retort
osmiophilic body during gametocyte

Who localised this protein by microscopy?

Lal, K., Delves, M. J., Bromley, E., Wastling, J. M., Tomley, F. M., Sinden, R. E.
Plasmodium male development gene-1 (mdv-1) is important for female sexual development and identifies a polarised plasma membrane during zygote development. (2009 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

during gametocyte, peripheral during macrogametocyte and microgametocyte, extracellular apical pole of ookinete protrusion during retort
  • "Indirect immunofluorescence assays show MDV-1 has a punctate cytoplasmic distribution in gametocytes. After activation of both females and males, MDV-1 is more peripherally located but in males exclusively it becomes concentrated in a few large foci. The retort stage ookinete develops from the zygote by increasing growth of an apical protrusion and MDV-1 locates at the leading extracellular apical pole of this protrusion. In the fully developed ookinete MDV-1 is localised to the posterior pole."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA clone 234
  • Gene model mapping comments: taken directly from publication
  • Localisation record: punctate during gametocyte, peripheral during female gametocyte, large foci peripheral during male gametocyte, extracellular apical pole of ookinete protrusion during retort
  • Other genes localised in this publication: -

Ponzi, M., Siden-Kiamos, I., Bertuccini, L., Curra, C., Kroeze, H., Camarda, G., Pace, T., Franke-Fayard, B., Laurentino, E. C., Louis, C., Waters, A. P., Janse, C. J., Alano, P.
Egress of Plasmodium berghei gametes from their host erythrocyte is mediated by the MDV-1/PEG3 protein. (2009 Aug, Cell Microbiol) PubMed / full text
   more detail about this publication

during macrogametocyte and microgametocyte and not ring and not schizont and not trophozoite, osmiophilic body during gametocyte
  • "Immunofluorescence analysis of fixed P. berghei asexual parasites (ring, trophozoite) and gametocytes using anti-MDV-1/PEG3 antibodies. Specific fluorescence is detected exclusively in gametocytes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during ring and troph
  • Other genes localised in this publication: -
  • "This, and the observation that no schizonts were ever found to be GFP-positive, strongly suggested that the GFP fluorescent cells were gametocytes."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during schizont
  • Other genes localised in this publication: -
  • "Analysis of purified mature gametocytes from this line by fluorescence microscopy and FACS identified two populations with clearly different fluorescence intensities (Fig. 2B). FACS sorting and Giemsa staining of the cells from the two populations showed that cells with the lower GFP fluorescence were male and those being more strongly fluorescent were female gametocytes (Fig. 2B)."
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: strong during female gametocyte, weak during male gametocyte
  • Other genes localised in this publication: -
  • "Anti-MDV-1/PEG3 antibodies. The MDV-1/PEG3-specific gold particles are mainly associated with osmiophilic bodies (Ob)."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: osmiophilic bodies during gametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48164

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_143220 male development gene 1
MKCINIPTSTIGCLLLFFLSSQNAQYECMNIKGSSNNGSGGKANFNVQDGKLNTKWSDNGYSFMDLIKNGYVKNKDLDDI
KDDLASELATKIQNSISKYIKEDNDEDELNDDDIKNLKIYVKEISGYVGLKAADLLDKNLESALKPLIENKSFDKSESKL
SNEGTSSFRFNNEIIDDEDPEEEIDHFADDLTDKYEVKQNENLEQYEKDINPHH

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_143220

General Sub-Cellular Localisation Links