ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_143170 ()

seryl-tRNA synthetase, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_143170 seryl-tRNA synthetase, putative
MHKIILSILLVLCIYFVLGKCIKHPSIKLFINTTTYSCKSNDFNLIKKKKRENTKWSNLISSNLNSYNKKGEDGKLNTPN
KGECEDQDKVGLSLKFLKENEQKVIENLKKRGIEKKLEDINVMKNLIHEKNQLEIVRNNLRNKRKILSDKVKDLMLKNKN
ILMDENRRNNSTNNNDNEFYNANKDGCVNEKNINIIKNEISNINENINLNEAKMFELKNKIEEHFNRLPNILLNKVPEGI
NSKSNKIVKTYKTKNINIWDDNDGNFLDPHENIIKRYDNNNDNIFKNISNKIGFGYNILVNNIANLERALINFMINVHTN
KFNYTYVKAPTIISRSALTNTGQLPKFENDLFKINQDYKILNEEAFLIPTSEVSLLNLFKNSLIEHEHLPIKLVSHSPCF
RIEKNYTYGKTSKGLLREHIFEKVELISITDKITSFLHYKNLIKHCEYILKKLKIPYRLVLLNSIETPFSASICYDIEAW
LPSQKRFLEVSSCSNCLDFQARKLNLKFKKNDKSLFCHTINGSGLAVGRVLAIILEQYQIKRSSKNDKIRLTVPKVLRRY
MKESIIDL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_143170

General Sub-Cellular Localisation Links