ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_141890 (RAB11A)

Rab GTPase 11a, a gene from Plasmodium berghei

Compiled localisation
cytoplasm during gametocyte and trophozoite
apical during schizont

Who localised this protein by microscopy?

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

cytoplasm during gametocyte and trophozoite, apical during schizont

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10424

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_141890 Rab GTPase 11a
MSMKEDYYDYLFKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSIQLKNDKIIKAQIWDTAGQERYRAITSA
YYRGAVGALLVYDITKKNTFENIEKWLKELRDNADSNIVILLVGNKSDLKHLRVINDNDATQFAKKEKLAFIETSALEAT
NVELAFHQLLNEIYNVRQKKQATKSEDNVNIQPRGKKINVDNDNDEDEKKTKTKCC

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_141890

General Sub-Cellular Localisation Links