ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_141570 ()

transcription factor with AP2 domain(s), putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_141570 transcription factor with AP2 domain(s), putative
MNNRGNYPQINDEMKCIENENMNCKLNNEHNTNYNNSQINSYNNNYSGVHENNELTNSNLCLNSNILQNNYYNNKIKDSQ
RYYKKRILIDHKNNMNNSEIHEYNCDSEKYREKMYSNSTINIGNYRNYINKDNCDYNINMYNNTNKIENTNIHMLNETNK
NYNYPNNSKYHKIYTECNNDHISGENNYTKCLNSIINNGNIGDITKNNFPASNNNSANFNDQCNDIKNKNNSSNNFQQYN
NSFVYGQNMSNEDSTNNNQYYEYVNHNFNMRLPNGTTNYLDNGISRNSSNSNNIKENYLLRNNMIHSLEDPRYNTNNSDN
NNYEENSFNNHNYPNSSGEYNDNYRNEDRNIHGWNYNTYYNNNCNNPIGEDSDSNLGNNSDSNICNNTVTNSNNNTVNIM
INNSNGTIMNSNTGDNNINDNVNNNVDTVLYKYNIKNNTDHMILFTDNEKGRFDSNNNIYMNNNYLTVDQCYANDTINGK
NTSRCTNTSINIDSSNPTIATSSIYDDNTISNKTIGNNNYMFNVTTQNCDMINSNITTKYDTSFLSNFEQDDNECNTEND
LDIDTVSDDYYNKTNYRYENISQRNSNNNAFDARDSGGSIANLDSINDSDLFNQYNNPGLNGIVNKFSGNTNINGHISRE
NSNGSNKKYSNSIPKNNEIAMRSYQTVGNYKQYSENKNFIYSDTDMCNNIENSRNAQDYENKLNGLNSQGVEITYIRKDD
DNINTQNVKYNKYQKNDKLSINSISNNSNNNYIPSKSNNPSNYVLDNYNLNESCNILNNNGSITSLINISNSTDKLNNYN
YNSLNNINMKDSNINMGHLEKYSINVVNNILITNPKEYKNSTQIENIENTQLLYNDGNNSDAMSATKCSNNNNGTNYRKM
NNNIIFYHNKNIETKEGTYRICKNTNKNSVSGSIYNQLYDKTFESNNLPNYNIKNENIDNIAFLLNLNNQKNNRLSNNSK
NYNNMNVMANDEHDTHYISSMNNMKNTNTKYYSNTNKNINSENTYDYLTNQPYDVNICTSSGSNNNINRDNNIYNGYGNK
NNNDYTQWVLNSRHMGSEENKSSISMGNGYNANSYLVDNNNNMVHSNSRNANKSLPALCDNNMHNNYMPLKKYYENNYNS
KNNNIRSNPNVCTDNSNDIDSDIANDMNNLNMLIIPKIKGVRFDKSGRRWVASWSQNGNQKRQYFPIKKFGKAQAKYLAI
YARIKAVKCMQKKTNKNPENKRSYSKKLTNKDKTKQEKDETQNMEYFNDTGEDYTDKFIPYENNLCHNGSESSANKTDEL
YNESEDENYTKKFSRYMTEENYKLLAKVTSNTTEFNNYMNGHNKTENNLHTLSRDINQNENPTINTNIENGDDNTDKNSN
SSSEVDDKQSCLEEKTNINNYIKETGNIQMEQYAHNINNNINNPSDSYNFNMNGNSLSEEKKDKIYEVPENTMNIEIPYS
NLTNELKDNQNNTIQFGKCPNMVTNNNDITSNKFANNTNNNSNLKNDNENTEACENNIQNTLESINNTNSYSSEPSNTNN
DQTGKGENLLLQINDEVNSNEQMLIQNEESSNATIKNDENASEKNDKEFYDPNVVTNNVNDNNINEKLKNMILLIERLNK
KNMKIIKNTNEKINIQFIENEVTINNQNDNYINNIHQINTLNFNDKLLLLKMLKEYYMKGNCLKNNTSNDLAVNKGGNKL
TNINQNFEPIEDRNTNTNNVDNVDISNQDDDNDDNNNLISEKLEKEIHSKSKKHTTERTYDNYADVNNKKVKTSYEDISN
IMIQGVDKNDILSVKEKTNDITKSDGNSNNGLLNCGELQNNEVTNEMNKNKKNTNDSNIPDNGSTNIGLLAHVKNEIIKK
LNDTISCKSNNQVEFKEDLKKNITEKGENTLIFKTNNQNHGDEEQQNDSYNVNSLNVKNDQENTTNDDAATISTSTASIK
KIYNNEENINNKNNDKNEICDPDDLPKDIDCNIPNNNHSGQSNFFFKNYYTYENPNNVNNIGLNSNNNYEYNCNNSGNYQ
IDGNINNNCEENDGEDTNENHKHTKKVESLSSYPSTVINGICNKIPQINNVTSKELQFHDYTKQTSFNNNSLKHNNSYQD
FSITSENANSKKFIPYNIGNKNNLTIASISTIHEPTDASTIGSPQRSYPNDHLICELNHEQNINDSKIDTSYYEGNKANF
IRNVLHMNTGNDILINDTNELESDINDDAFNETHETTNMDEINKSRDYCNDLDKNQIDHSQYKQYTEHVKNNDKGHIIHA
FPQYSFGNHYDSKNNFSKIIPTSEKGHNNGYPVIADTKNGLRNTKNMDNINDMSNNLSSNENTPNYVNINKEYKNVHISE
LTDIDRTRMSNIPYLIRNEYDNFYSKNDLFYDPNYSTHNKHIDSNNSNIIEKGNNILLQNGFNVDMNIPYMNLTSLPSSV
IVNEQICIEEDQKNDISFLNTQLFNYKHNMDIMQNAMNPNNDHENVQHTGDNNGTLYNSRNNNTNNISDNAYNIPTNNTA
YISQMEM

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_141570

General Sub-Cellular Localisation Links