ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_141510 (ECT)

cholinephosphate cytidylyltransferase, putative, a gene from Plasmodium berghei

Compiled localisation
cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Dechamps, S., Wengelnik, K., Berry-Sterkers, L., Cerdan, R., Vial, H. J., Gannoun-Zaki, L.
The Kennedy phospholipid biosynthesis pathways are refractory to genetic disruption in Plasmodium berghei and therefore appear essential in blood stages. (2010 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during ring and schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11749

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL13P1.86 cholinephosphate cytidylyltransferase
  • PY02436 cholinephosphate cytidylyltransferase
  • PVX_122650 cholinephosphate cytidylyltransferase, putative
  • PCHAS_141690 cholinephosphate cytidylyltransferase, putative
  • PKH_141580 cholinephosphate cytidylyltransferase, putative
  • TGME49_016930 cholinephosphate cytidylyltransferase, putative
  • NCLIV_059380 SJCHGC06128 protein, related
  • cgd8_1150 choline-phosphate cytidylyltransferase
  • Chro.80135 cholinephosphate cytidylyltransferase
  • CMU_025070 choline-phophate cytidylyltransferase protein, putative
  • TP02_0826 cholinephosphate cytidylyltransferase, putative
  • TA15365 CTP:phosphorylcholine cytidylyltransferase, putative
  • BBOV_II005220 choline-phosphate cytidylyltransferase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_141510 cholinephosphate cytidylyltransferase, putative
MIKVNSVQTSESQGPDQNENENKDNKSIRIYADGIYDLLHLGHMRQLKQAKYMDKNVTLIVGVCSDIDTRKFKGQIVQTL
DERTETLKHIRWVDEIVSPSPWVITPDFVEEYNIDYVAHDDIPYASNQKKKKKKKGKSSITVTNGNNGNTCEEQTDDVYA
WLKKAGKFKATQRTSGVSTTDLIVRILKNYEDYIERSLQRGIHPNELNIGVTKAQSIKMKKNLIRWGEKVTDGITKVTLT
DKPLGTDFDQGIDIIRDKAHELFKLWRHHSKKLLKDFAKSFDPMFTIIRKKNKKDNPSTMYLSDSNIFLRTMKEHAKIKK
SLSNTINNIDEYYYSVDEDWSRIHNTVYNAINRFNPDIYNNDADNYQTCFELEASIKDKRKQNKMFLDCYNDSLTTNSDK
KVGFFIPEENYKHEYNPNNVSNKPFNSFGNIYNDNKIDAYNATTYHDILDEDEVFSDCFLKKNNESCENTQNNSEAIGNV
NFDNSNSIFNNISKDNKNKTTVKDGYNTCVEHLLNDNKYNHIIVNNKRNLNKIKSVNTMKANEFSDTIKISEEDKKANNM
NNEDSKPFNQNRSNDINDDNVDIHENVVVYADGVYDMLHLGHMKQLEQAKKLFPNTTLIVGVTSDNETKLYKGQIVQSLE
ERTETLKHVKWVDEIISPCPWVITPDFIEKYQINYVAHDDIPYANNQKKKTKDNNSNTNNGNTCEEQTDDVYAWLKKAGK
FKATQRTSGVSTTDLIVRILKNYEDYIERSLQRGIHPNELNIGVTKAQSIKMKKNLIRWGEKVTDGITKVTLTDKPLGTD
FDHGIENLQIKFKELYKIWKNASHKLINDFTSKLDTTYYLASLQSFMDNDCDLYDYASSNFDDETSS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_141510

General Sub-Cellular Localisation Links