ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_136200 ()

glutamate - tRNA ligase, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12056

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_136200 glutamate - tRNA ligase, putative
MIKDSKINIYYGKNYPFLCRTVFNIYQNNIKKKTANNLNDKKIKEICVNFINDKTVVEDIKVEFVRNTVSDQTRKNTNTN
NSVTSSDKIFAINLDFLLKTNLYYFTSYRENINRNIITNVFFQAQYNEWIDFLRNKDIEKNIIPICEHINKHLYLNTFLS
FHYLTLSDIYIYYEMHKYFSGNITTNLKYPKQYKNINRWFRLIKALLHDHVATDAELIQNLKVKEKIFNTAGSGKRLGNN
GNKYSAHSDHTNTKGGATSLSSYEGKLQNAEKGKVVTRFPPEPSGYLHIGHIKAAFLNNYYANIYEGKMLLRFDDTNPVL
EDVKFENSIIEDLETLSIKYEKISYTSDYFQLLEEYCIKLIKMNKAYADDTNVDEMRNQRGEGIESVNRNNSIETNLKLF
EEMRNGTDIGKKNCIRAKINMSSKNKCMRDPVLYRCIIDIPHHRHGFKYKCYPTYDFACPIIDSIEGVTHALRTNEYSDR
IEQYNWFIYTLELRNVHIYEFSRLAFVKTVMSKRKLKWFVENNIVDGWTDPRMPTIKGILRRGLTKEALFQFILEQGPSK
AGNLMQWDKLWSINKQIIDPNIPRFSSVDMNNGVILKLTDLKENEIIEKTRDLHVKNKSLGTCTMYYTQQIYIELEDAQM
IEANEEITLIKLGNVIVKEIIKDTDNVNKIKEIIAVSNFDGDFKTTKKKIHWLPYIPDKLINCTLYEYDHLITVDKFEND
NKEDWTNCINQNSKFETVAYAEPALIDLKVSDKFQFERRGYFIVDKITENKHFHLIKIPDGKSKNMSIISTKVNPQNLSG
TKK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_136200

General Sub-Cellular Localisation Links