ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_136050 (CCT)

ethanolamine-phosphate cytidylyltransferase, putative, a gene from Plasmodium berghei

Compiled localisation
cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Dechamps, S., Wengelnik, K., Berry-Sterkers, L., Cerdan, R., Vial, H. J., Gannoun-Zaki, L.
The Kennedy phospholipid biosynthesis pathways are refractory to genetic disruption in Plasmodium berghei and therefore appear essential in blood stages. (2010 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during ring and schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11057

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0253 ethanolamine-phosphate cytidylyltransferase, putative
  • PY06073 hypothetical protein
  • PVX_083280 cytidyltransferase domain containing protein
  • PCHAS_136510 ethanolamine-phosphate cytidylyltransferase, putative
  • PKH_120620 ethanolamine-phosphate cytidylyltransferase, putative
  • TGME49_110280 phosphoethanolamine cytidylyltransferase, putative
  • NCLIV_054370 phosphoethanolamine cytidylyltransferase, putative
  • cgd7_2950 phospholipid cytidyltransferase HIGH family
  • Chro.70332 CTP:ethanolamine cytidylyltransferase
  • CMU_022910 ethanolamine-phosphate cytidylyltransferase protein, putative
  • TA07160 CTP-phosphoethanolamine cytidylyltransferase, putative
  • BBOV_I004300 ethanolamine-phosphate cytidylyltransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_136050 ethanolamine-phosphate cytidylyltransferase, putative
MSNEFLVDTIYNHEYLKKVLGLIKSIKKNNKFDYIEKIYEQFNIEENEEIYNKFFNELENINNNGNINSNNRRRNGNYIN
KYASNYNNVNCCNNNNHHCSGNPSIIPEYDKDANSYLSNNSEEINEFDIDSYDSSFEKKAKEKRIYVDGIFDLSHSGHFN
AMRQAKKLGDVVVVGINSDEDALNSKGVTPIYTQEERGALIAGCKWVDEVIIGTKYNVDMELLKKYNCDYAAHGSDIAYD
RNGVCCYEDVQKNNRLKVFERSYGISTTIIVNHLLQIVSNANRIGSSHIHNLKNNTLLDVKDEEKNKNCDANSMGSLENI
VDNINSTEDKTNLKNGKNDSNDIDNNNIKMVKGDKKKNSDMSSNIKSLMNKNKGYIAASQIYLFMEKHEKKKHHKVVYVD
GSFDMFHLGHLKIIENAKKLGDYLLVGIYSDETVRKLKGNHFPITSVLERTLTVLAMKGVDDVVICAPWVITEGFIKRFQ
IDTVVRGSISDYNYSSFGADPYTIPKKLNIFKEIPSASDMTTFEIINRIEKNKQYLLSIISARKKKEENIWKNNSYTLK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_136050

General Sub-Cellular Localisation Links