ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_135570 (MyoA)

myosin A, a gene from Plasmodium berghei

Compiled localisation
apical during mature ookinete
apical most tip during ookinete

Who localised this protein by microscopy?

Siden-Kiamos, I., Schuler, H., Liakopoulos, D., Louis, C.
Arp1, an actin-related protein, in Plasmodium berghei. (2010 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical most tip during ookinete
  • "this was shown by the co-localization with the MyoA protein which is restricted to the apical-most tip (three representative ookinetes are shown in Fig. 5A). "
  • Microscopy type: Fixed light
  • Microscopy method: antibody
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: apical most tip during ookinete
  • Other genes localised in this publication: actin-related protein, circumsporozoite- and TRAP-related protein, actin, putative

Siden-Kiamos, I., Pinder, J. C., Louis, C.
Involvement of actin and myosins in Plasmodium berghei ookinete motility. (2006 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical during mature ookinete
  • "Western immunoblots revealed that PbMyoA is only present in fully mature ookinetes, whilst the other two proteins are additionally expressed in gametocytes and zygotes. Immunofluorescence experiments reveal that MyoA and actin co-localize in the apical tip of the parasite whereas MyoB displays a punctate pattern of expression around the entire cell periphery"
  • Microscopy type: Light
  • Microscopy method: IFA from antibodies
  • Strain:
  • Gene model mapping comments: Blast from AF286048, annotation matches
  • Localisation record: apical tip during mature ookinete
  • Other genes localised in this publication: actin, putative, myosin pfm-b, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10145

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_135570 myosin A
MAVTNEELKTAHKIVRRVSNIEAFDKSGVVFKGYQIWTNISPTIEEDPNVMFVKCVVQHGSNQDKLNVVQIDPPGNGTPY
EIDIKNAWNCNSQVDPMSFGDIGLLNHTNTPCVLDFLKHRYLKNQIYTTACPLIVAINPYKDLGNTTDEWIRKYRDASDH
TRLPPHIFSCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMKYFASSKNGNMDLYIQTAIMAANPVLEAFGNAKTI
RNNNSSRFGRFMQLAISHEGGIRNGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGADKNMKAKFGLKGIKDYKLLNPNS
PDVDGIDDVKDFQEVVASLKNMQLNDEQIEVIFSIIAGILTLGNVRIIEKTEAGLSDAAGIHNDDMEIFRKACELMFLDP
ESVKRELLIKVTIAGGNRIEGRWNKNDAEVLKLSLCKAMYEKLFLWIIKNLNSRIEPEGGFKAFMGMLDIFGFEVFKNNS
LEQLFINITNEMLQKNFVDIVFERESKLYRDEGISTAELNYTSNKEVISVLCERGKSVLSYLEDQCLAPGGSDEKFVNAC
VVNLKSNEKFIPAKVASNKNFIIQHTIGPIQYCSDNFLLKNKDVLRGELVEIILGSENKVVSGLFEGQVIEKGKMAKGSL
IGSQFLNQLTSLMTLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFDEFLYQFKFVD
INTSENSALDSREKCNQILKISGLSDDMLKIGKTMVFLKQDGAKMLSKMQREKLVEWENCVSVIEAAIMKYKHKQNVENN
VSSLMRVQAHIRKRMVA

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_135570

General Sub-Cellular Localisation Links