ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_134030 ()

phosphoribosylpyrophosphate synthetase, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10196

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF13_0143 phosphoribosylpyrophosphate synthetase
  • PBANKA_134030 phosphoribosylpyrophosphate synthetase, putative
  • PY00920 phosphoribosylpyrophosphate synthetase
  • PVX_116620 phosphoribosylpyrophosphate synthetase, putative
  • PCHAS_134490 phosphoribosylpyrophosphate synthetase, putative
  • PKH_122800 phosphoribosylpyrophosphate synthetase, putative
  • TGME49_020100 phosphoribosylpyrophosphate synthetase, putative
  • NCLIV_012230 Ribose-phosphate pyrophosphokinase (EC 2.7.6.1), related
  • TP01_0994 phosphoribosylpyrophosphate synthetase, putative
  • TA16730 phosphoribosyl pyrophosphate synthetase, putative
  • BBOV_IV008060 ribose-phosphate pyrophosphokinase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_134030 phosphoribosylpyrophosphate synthetase, putative
MNYSAFKGYASNWLNRKSILMKKGNGSKIALIASSGIGMYILSNEENRKELRSRCNNIKKCIDNMVYQYNNKNKIFFENL
VLCDNNNSNKGFRNPLWRSEEKRPIDKMENAIIFSGSSNPLLSKKITDHLSTTLGKVNLKRFADGEVSMQFLDSIRGKDV
YIIQPTCPPVNENLIELLLMISTCRRASAKKITAVIPYYGYARQDRKLSSRVPISAADVARMIEAMGVDRVVAIDLHSGQ
IQGFFGPRVPVDNLEAQLIGLDYFTKKNLYKPVIVSPDAGGVYRARKFQDGLNYRGMSDCGIAMLIKQRNKPNEIEKMDL
VGNVYDSDVIIVDDMIDTSGTLCEAAKQLKKHGARRVFAFATHGLFSGPAIDRIENSPLEEVVVTDTVKSNKNIDNCKKI
TKLSVSVLVADAIRRIQQKESLNDLFSMKG

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_134030

General Sub-Cellular Localisation Links