ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_130130 (CITH)

trailer hitch, putative, a gene from Plasmodium berghei

Compiled localisation
p-body during macrogametocyte

Who localised this protein by microscopy?

Mair, G. R., Lasonder, E., Garver, L. S., Franke-Fayard, B. M., Carret, C. K., Wiegant, J. C., Dirks, R. W., Dimopoulos, G., Janse, C. J., Waters, A. P.
Universal features of post-transcriptional gene regulation are critical for Plasmodium zygote development. (2010 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

p-body during macrogametocyte
  • "The CITH::GFP fusion protein is present in characteristic foci in the cytoplasm of live parasites."
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: ANKA
  • Gene model mapping comments: taken directly from publication
  • Localisation record: P-body during female gametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11065

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_130130 trailer hitch, putative
MSSVSTLPYIGSKISLISNSEIRYEGILYTINTHESTVALQNVRSYGTEGRRQPDIPASNEVYDFIIFRGKDIKDVTVSE
APKTIPDDPAIVSMNIAPSTKNNIGDNLNYNNNVNNINKPLNVQNNMIPQNERNVNLNNRRYYNRHNYNYYYNGNIGNGN
MNSNANHNNNHNNNRHYNNFKYKNYRNYDRQSYVIGELESQPNPVLKSKFSPDFDFSSNNLKFDKTNIIDEKSKDVLSAN
SNIQVGGYDKKSSFFDNISCETLDKQQGKDEKVDREKLRMLDVDTFGIAAAHYRTNMHNRNNNRNKGRNSKNNKMMGNFN
YNYYNRNQNPFNRYPAY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_130130

General Sub-Cellular Localisation Links