ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_122210 ()

regulator of chromosome condensation protein, putative, a gene from Plasmodium berghei

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_122210 regulator of chromosome condensation protein, putative
MKNVKNTLFIFGSGECGQLPPEYCDEYIQINPTAVRDLPYNIEEVVCGSMHTIIKTKDDKIYSFGCNDMGVLGRKTFSNS
TKDPEHTPTLINFSFPSKIKKITCGDNHTAVLLYNGKVYIAGGFRDSSGVLGIPSFSKYDKVLPKTDEFIEIKFKLPENE
NENESDKESDIDESDIDESDIGESEPNCCKIINIVSGEDHLICLEKNRKHIFTMGNSDSCQVCNPYYSQEESEKNRIKYL
FPNCYHYKDFGFINKFKNIYCGGNNTFIQLSKSLDVYGIGRNAYGSCGVNLKDNIIKKFEKINELSNKKIKQLCGGQSFT
VCLLKNNDLYIWGNKEILGMEYHDDSFNPIKLNFFKNNNYIIKKLFCGTDHCLVLTENDKLFGWGTGGNEFDENTSIAVI
EQNNPSEINFIKYFNKEMFKDNMNNSDILINQINIASFSGGSSHCALISSHTFSEKVSLKRGHDESYHEDVYMKKQKMEQ
ILNSSGKNYVIMTECDNKISTDDTEDIKKKSFLGSFYFSSTKSNNKDSKLSKDEFQINKNESSQNNINQYDTATDDDAAK
KRSAKNKSYLNIENPTRRQPRRSCKENISLKENANRQFYQIVNESISKKKRKTDFDIKSNQNQVFDEKKESKSLAAKNNK
RKSMARTSAK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_122210

General Sub-Cellular Localisation Links