ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_121770 (DOZI)

ATP-dependent RNA Helicase, a gene from Plasmodium berghei

Compiled localisation
p-body during macrogametocyte

Who localised this protein by microscopy?

Mair, G. R., Braks, J. A., Garver, L. S., Wiegant, J. C., Hall, N., Dirks, R. W., Khan, S. M., Dimopoulos, G., Janse, C. J., Waters, A. P.
Regulation of sexual development of Plasmodium by translational repression. (2006 Aug 4, Science) PubMed / full text
   more detail about this publication

p-body during macrogametocyte
  • "PbDOZI::GFP, a modified P. berghei line expressing GFP-tagged DOZI, showed punctate localization in the cytoplasm of female gametocytes. "
  • Microscopy type: Light
  • Microscopy method: C terminal GFP tag
  • Strain: ANKA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: P-body during female gametocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11252

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_121770 ATP-dependent RNA Helicase
MSYKTNCVASNANTNALNNSNNLNKIEDNVIFDEAWKKKILEPLKDPRYKTEDVTKTKGNEFEDYFLKRELLMGIFEKGY
EKPSPIQEESIPVALAGKNILARAKNGTGKTAAFAIPLLEKCNTHKNFIQGLILVPTRELALQTSAMIKELGKHMKIQCM
VTTGGTSLREDIMRLYNAVHILCGTPGRILDLANKDVANLSGCHIMVMDEADKLLSPEFQPIVEELMKFLPKEKQILMYS
ATFPVTVKEFRQIYLSDAHEINLMDELTLKGITQYYAFVKERQKVHCLNTLFAKLQINQAIIFCNSITRVELLAKKITEL
GYSSFYIHARMSQTHRNRVFHDFRNGACRCLVSSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRYGHLGLAINL
ITYEDRFNLYKIELELGTEIQPIPNEIDPSIYT

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_121770

General Sub-Cellular Localisation Links