ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_110330 (MyoB)

myosin pfm-b, putative, a gene from Plasmodium berghei

Compiled localisation
peripheral during gametocyte and mature ookinete and zygote

Who localised this protein by microscopy?

Siden-Kiamos, I., Pinder, J. C., Louis, C.
Involvement of actin and myosins in Plasmodium berghei ookinete motility. (2006 Dec, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

peripheral during gametocyte and mature ookinete and zygote
  • "Western immunoblots revealed that PbMyoA is only present in fully mature ookinetes, whilst the other two proteins are additionally expressed in gametocytes and zygotes. Immunofluorescence experiments reveal that MyoA and actin co-localize in the apical tip of the parasite whereas MyoB displays a punctate pattern of expression around the entire cell periphery"
  • Microscopy type: Light
  • Microscopy method: IFA from antibodies
  • Strain:
  • Gene model mapping comments: Never sequenced, antibody was to falciparum MyoB, took orthologue from PFE0175c
  • Localisation record: punctate peripheral cytoplasm during mature ookinete and gametocyte and zygote
  • Other genes localised in this publication: actin, putative, myosin A

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_110330 myosin pfm-b, putative
MKNANELSDYLRVNSEFVDKSKNGFEGGNFYIWTHKSPNATLYPDVVFFKCLVLSVDGQNYRVKETIPETNSEYVVKKED
LFNCNSIINVDNHRLNDMIHHNSAEVLNMLCLRYKKNYIYTIAEPMLISINPYQVIDVDINEYKNKNTNELPPHVYSYAK
EAMADFINTHTNQSIIISGESGSGKTEASKLVIKYYLSGIKEDNEISNTLWDSNFILEAFGNAKTLKNNNSSRYGKYIKI
ELNEYQNIVSSSIEIFLLENIRVVSQEEEERGYHIFYQIFNGMSQELKNKYKIRSENEYKYIVNKNVVIPEIDDSKDFGN
LMISFDKMKMHDMKGDMFLTLSGLLLLGNVEYKEIEKGGKTNCSELDETNLELVNEISNLLGINYENLKDCLVFTEKTIA
NQKIEIPLSVEESVSICKSISKDLYNKIFSYITKRINNFLNNNKELNNYIGILDIFGFEIFSKNSLEQLLINIANEEIHS
IYLYIVYEKETELYKAEDILIESVKYTTNESIIDLLRGKTSIVSILEDSCLGPVKNDESIISVYTNKFSKHAKYASTKRD
INKNFVIKHTVSDVTYTITNFISKNKDILPSNIVRLLKVSNNNLVRSLYADVEVSESLGRKNLITFKYLKNLNNIISYLK
STNIYFIKCIKPNENKEKNNFNQKKVFPQLFALSIIETLNISFFFQYKYKFDVFLSYFEYLDYSTSKDSNLTDKEKVSTI
LQNTVDPDLYKVGKSMIFLKKECVSKIREIINNNLKCYKNLCNIATAIVTRIKKKEVVELNIKNLQLAQAYFRKYKHMKE
LE

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_110330

General Sub-Cellular Localisation Links