ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_104010 (CK)

choline kinase, putative, a gene from Plasmodium berghei

Compiled localisation
cytosol during ring and schizont and trophozoite

Who localised this protein by microscopy?

Dechamps, S., Wengelnik, K., Berry-Sterkers, L., Cerdan, R., Vial, H. J., Gannoun-Zaki, L.
The Kennedy phospholipid biosynthesis pathways are refractory to genetic disruption in Plasmodium berghei and therefore appear essential in blood stages. (2010 Oct, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol during ring and schizont and trophozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11218

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PBANKA_104010 choline kinase, putative
MEDNNNRSNNIENGKIDLLNCNNNNNEDIKLLKIEKGLSYDDLEAFNSIQLNQETEILATPFRSQEINMKNDIPLCAQEF
SDLTDPLYIKKICLEKVTEWNKFTERDIYVKQILSGLTNQLFEVGLKECSVSQNPSIRKHILFRIYGKYVGELYNTDLEI
EVYETMSKYKISPKLLNTFSGGRIEEWLYGNPLKNEDLQNSKILIAIANMLGKFHTLAIKKTLPSHWDKTPCIYKRIKEW
KIQISKLKNLDKFKGDINKYYQESDKFIKFMNKYTKEDNIRNHITFCHNDLQENNIINTNNCLRLIDFEYAGYNFIATDI
AIFFIETSIDYSTDTYPFYEINKNHYISHENRKLFINEYLSIYLGKSQIPYDQKIVDSILDAIEIHALGANLLWGFWSII
RGYQVKCYNEFDFFLYAQDRFKLYDEQKKYLLSKNLIPDYD

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_104010

General Sub-Cellular Localisation Links