ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_103820 (MISFIT)

nuclear formin-like protein, a gene from Plasmodium berghei

Compiled localisation
nucleus during microgametocyte and oocyst and zygote
during not blood stages

Who localised this protein by microscopy?

Bushell, E. S., Ecker, A., Schlegelmilch, T., Goulding, D., Dougan, G., Sinden, R. E., Christophides, G. K., Kafatos, F. C., Vlachou, D.
Paternal effect of the nuclear formin-like protein MISFIT on Plasmodium development in the mosquito vector. (2009 Aug, PLoS Pathog) PubMed / full text
   more detail about this publication

nucleus during microgametocyte and oocyst and zygote, during not blood stages
  • "MISFIT is expressed in male gametocytes and localizes to the nuclei of male gametocytes, zygotes and ookinetes. ... MISFIT was not detected in asexual blood stage trophozoites or schizonts (data not shown)."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: ANKA 2.34, ANKA 2.33
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus during male gametocyte and oocyst and zygote, not during blood stages
  • Other genes localised in this publication: nucleosome assembly protein, 25 kDa ookinete surface antigen precursor

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>PBANKA_103820 nuclear formin-like protein
MATENEKLKKLTGKLLYLLNKYRHAYLMSIDLINFYDEVIEKKDDSNYKELEEFYKKKRPWEGIIDEEMIIRKKLKNNLC
YYEGKEHTKKIKTIETNDSEMLHSKGNDGNDSSNCSLSGIKIFKGDDSKLQDNNMENEDEKYNKNTSDYVSLGALDFSAY
KEDSDGHIKYYEKNKTDIKVDKTKKNNNNFSKYMHQSDVKKKNVLNQSIYMKNNNVKSSQIRILPHIHKNIYNADNSFSK
LNSAKKLNALNTYKSVYINSNIMHKNIGMDKKIVKNELNKNEFLQNNNLKGLNKSVYIGRREKSTCATSNSIIVPNRNNR
MSGPINESLILTSKNSLINKDGIKKQELLNKKMSVIKANNTHNNNIPLKKMNTLSILKNNNYISNKNGLNKSIYFSRSNT
LMSNDKKKKTNDSYVDQAKVGTVGDSNLNRKAEHINNLNFWGKNEVLDVEISKEIGIAIKDVETENTEQNSKKIFIDEKL
GIEKSDKINFPNVQKLSYSPLTLEDIEKLIKDEEKDKEISVNNNLNQSLIKENDFACMKKNICIDKDNLKNLVCLPEKNQ
TYIKIEKNCDDNGENISQINELKKEDKINGDNNKNTNFGASTINSENINNEVVGYIENPLSDNLIKVEKKIEEKSSEYAL
VKKEGNISMENNSNKMSYNEKCKITKDLEEENMDIDNKKDIKNIENINTKDNVKKLDYSAISCGHEEINRKNIILNINDE
IKEKIMERECVSGKVGNNSEENVFKKMSEKKMLISENIRKNLMSSLEKETGTKCSNINNRANLNIEIDLDCEYVSLDIVN
IDLAINEGLYNYKKNEESYIECDEQIKDIKIYNDILKSEKEICSDLLFIKKENQFNNNSVILFKSSNEIKNEISKYVGMS
IFDCINKFIIPTNSLVNDNRLSIWFTKKKKNNNNMNRSKDNNFDRIENYNDDSKIRRNFIFKKKSEGRLSCMGYFSQPIT
IMLSSLKRRSEFGNLKNIITSIILCTCDSSMLEIILHTIPDENSKNYQLWKTSIKKLYTLIGDRKKDILRNLIFSDKDKT
CETHEKDEREGYDENNLIEDKNKYNELNLKTYDFMNTMDNNGYRNFFNSSFSSEAGGNTPINQNNYFSTVPLSKTDIKTE
KYEEGKENNINILEDEKFCLFICTINDIHKRFQYLLLIENYDFIYSDLIKHIQNKLNNIDLIINKHMLLKQLFCNVLFLC
NWLNEPKCFKWFQWNDVFNKLYNLNGFLENGRISRERCILLLLAEHTGEIFTEKELNELKKTSKLHIKDLYDKSIDFINC
FLELKNQLETEEFKKSCCIFSSELEDVGVEKCSDNFLNDKVLKNDKFLEKVKDFVKKYYKQMVYIIWNLVLLIKKYLIVM
IWLGDVKPFYPLFSYLDEGKKIKYSEDLFVNLCHFFESYNKYFNIVKQSQEELQKGIGDTSYQGQNEKTKNIALNNSDDF
IFSADYFEKNTQKEANGIANDSNYTNFKGGNKPNYEVCELRKNKIVEMNNRNYNNGSEYTANNSYIENNDISIKNGNNVK
GMLHFMKNNGNLKTENYELKHRKSLTNTIDYGCEIRRKSIEKEKGNNNKFIKGASFENMDEAEFDSSA

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_103820

General Sub-Cellular Localisation Links