ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PBANKA_103780 (SOAP)

secreted ookinete adhesive protein, a gene from Plasmodium berghei

Compiled localisation
during retort
apical and not nucleus and not surface during oocyst and ookinete 24 hours after fertilization
microneme during ookinete 24 hours after fertilization

Who localised this protein by microscopy?

Dessens, J. T., Siden-Kiamos, I., Mendoza, J., Mahairaki, V., Khater, E., Vlachou, D., Xu, X. J., Kafatos, F. C., Louis, C., Dimopoulos, G., Sinden, R. E.
SOAP, a novel malaria ookinete protein involved in mosquito midgut invasion and oocyst development. (2003 Jul, Mol Microbiol) PubMed / full text
   more detail about this publication

during retort, apical and not nucleus and not surface during oocyst and ookinete 24 hours after fertilization, microneme during ookinete 24 hours after fertilization
  • "It encodes a predicted secreted and soluble protein with a modular structure composed of two unique cysteine-rich domains. Using the rodent malaria parasite Plasmodium berghei we show that SOAP is targeted to the micronemes and forms high molecular mass complexes via disulphide bonds."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: blast from AY046918, annotation matches
  • Localisation record: during retort, apical and not surface and not nucleus during ookinete 24 hours after fertilization and oocyst
  • Comment: strain information not found
  • Other genes localised in this publication: -
  • "Subsequent immunogold labelling of PbSOAP in thin sections of 24 h in vitro cultured ookinetes resulted in a large majority of gold particles associated with the micronemes (Fig. 2D)."
  • Microscopy type: EM
  • Microscopy method: antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during ookinete 24 hours after fertilization
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_54855

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PBANKA_103780 secreted ookinete adhesive protein
MKRILLFLIPLLFLIIKIEGARKNSIRNVVSAYPHNNNVKNFSAAEIFGPKTTGQECVKCLPENFCECECSCKNKTGFSM
KYRNASKGYKYLDSNSSNPLADVKASSRSDSNNQRHSLDAAAHAKGLKSATKSDNNDIDNGPVECFSSCKSVTGVQTEEC
SCSCYC

Proteomics

Found in:

Not found in:

Gene-Specific Links for PBANKA_103780

General Sub-Cellular Localisation Links